3 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp04311 | Lunasin | SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | Soyabean | Cell membrane degradation | TUNEL DNA fragmentation assay | MCF-7 | Breast cancer | Not found |
| dbacp05128 | PaDef | CETPSKHFNGLCIRSSNCASVCHGEHFTDGRCQGVRRRCMCLKPC | Avocado Fruit | Cell membrane degradation | Not specified | Not found | Not found | Not found |
| dbacp06164 | Stigmurin | FFSLIPSLVGGLISAFK | Venom gland, Yellow scorpion of the Northeast | Cell membrane degradation | MTT assay | SiHa cells | Cervical cancer | IC50 : 118 μM |