dbACP: A Comprehensive Database of Anti-Cancer Peptides

9 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp01965 Brevinin-2R KLKNFAKGVAQSLLNKASCKLSGQC Skin, Marsh frog, Europe Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death MTT-assay HT29/219 Colon carcinoma LD50 : 10 – 15 μg/ml
dbacp01966 Brevinin-2R KLKNFAKGVAQSLLNKASCKLSGQC Skin, Marsh frog, Europe Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death MTT-assay HT29/219 Colon carcinoma LD50 : 20 – 25 μg/ml
dbacp01967 Brevinin-2R KLKNFAKGVAQSLLNKASCKLSGQC Skin, Marsh frog, Europe Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death MTT-assay HT29/219 Colon carcinoma LD50 : 30 – 40 μg/ml
dbacp01968 Brevinin-2R KLKNFAKGVAQSLLNKASCKLSGQC Skin, Marsh frog, Europe Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death MTT-assay SW742 Colon carcinoma LD50 : 10 – 15 μg/ml
dbacp01969 Brevinin-2R KLKNFAKGVAQSLLNKASCKLSGQC Skin, Marsh frog, Europe Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death MTT-assay SW742 Colon carcinoma LD50 : 20 – 25 μg/ml
dbacp01970 Brevinin-2R KLKNFAKGVAQSLLNKASCKLSGQC Skin, Marsh frog, Europe Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death MTT-assay SW742 Colon carcinoma LD50 : 30 – 40 μg/ml
dbacp02560 Cr-AcACP1 AW(Ac)KLFDDGV Not found Inducing apoptosis MTT assay Not found Colon carcinoma Not found
dbacp06145 Ss-arasin MERTLLIVLLVCFLLLAVTAEA The Indian mud crab Membrane disruption by pore-formation or by permeating the membrane and acting on intracellular targets MTT assay HT-29 Colon carcinoma IC 50 : 2.90 μM
dbacp06147 Ss-arasin SPRVRRRYGRPFGGRPFVGGQFGGRPGCVCIRSPCPCANYG The Indian mud crab Membrane disruption by pore-formation or by permeating the membrane and acting on intracellular targets MTT assay HeLa Colon carcinoma IC 50 : 3.06 μM