9 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp01965 | Brevinin-2R | KLKNFAKGVAQSLLNKASCKLSGQC | Skin, Marsh frog, Europe | Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death | MTT-assay | HT29/219 | Colon carcinoma | LD50 : 10 – 15 μg/ml |
| dbacp01966 | Brevinin-2R | KLKNFAKGVAQSLLNKASCKLSGQC | Skin, Marsh frog, Europe | Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death | MTT-assay | HT29/219 | Colon carcinoma | LD50 : 20 – 25 μg/ml |
| dbacp01967 | Brevinin-2R | KLKNFAKGVAQSLLNKASCKLSGQC | Skin, Marsh frog, Europe | Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death | MTT-assay | HT29/219 | Colon carcinoma | LD50 : 30 – 40 μg/ml |
| dbacp01968 | Brevinin-2R | KLKNFAKGVAQSLLNKASCKLSGQC | Skin, Marsh frog, Europe | Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death | MTT-assay | SW742 | Colon carcinoma | LD50 : 10 – 15 μg/ml |
| dbacp01969 | Brevinin-2R | KLKNFAKGVAQSLLNKASCKLSGQC | Skin, Marsh frog, Europe | Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death | MTT-assay | SW742 | Colon carcinoma | LD50 : 20 – 25 μg/ml |
| dbacp01970 | Brevinin-2R | KLKNFAKGVAQSLLNKASCKLSGQC | Skin, Marsh frog, Europe | Activates the lysosomal-mitochondrial death pathway; Involves autophagy-like cell death | MTT-assay | SW742 | Colon carcinoma | LD50 : 30 – 40 μg/ml |
| dbacp02560 | Cr-AcACP1 | AW(Ac)KLFDDGV | Not found | Inducing apoptosis | MTT assay | Not found | Colon carcinoma | Not found |
| dbacp06145 | Ss-arasin | MERTLLIVLLVCFLLLAVTAEA | The Indian mud crab | Membrane disruption by pore-formation or by permeating the membrane and acting on intracellular targets | MTT assay | HT-29 | Colon carcinoma | IC 50 : 2.90 μM |
| dbacp06147 | Ss-arasin | SPRVRRRYGRPFGGRPFVGGQFGGRPGCVCIRSPCPCANYG | The Indian mud crab | Membrane disruption by pore-formation or by permeating the membrane and acting on intracellular targets | MTT assay | HeLa | Colon carcinoma | IC 50 : 3.06 μM |