2 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp03333 | Human beta defensin 3 | GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK | Skin, tonsils, oral/saliva, colonic mucosa, Human | Cytoplasmic membrane disintegration | Not specified | Not found | Not found | Not found |
| dbacp04154 | LL-37 parent | [LL-37, 37 aa] | Neutrophils, monocytes; mast cells; lymphocytes, Mesenchymal Stem Cells; islets; skin, sweat; airway surface liquid, saliva; colonic mucosa; bone marrow and testis, Human | Cytoplasmic membrane disintegration | Not specified | Not found | Not found | Not found |