dbACP: A Comprehensive Database of Anti-Cancer Peptides

2 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp03333 Human beta defensin 3 GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK Skin, tonsils, oral/saliva, colonic mucosa, Human Cytoplasmic membrane disintegration Not specified Not found Not found Not found
dbacp04154 LL-37 parent [LL-37, 37 aa] Neutrophils, monocytes; mast cells; lymphocytes, Mesenchymal Stem Cells; islets; skin, sweat; airway surface liquid, saliva; colonic mucosa; bone marrow and testis, Human Cytoplasmic membrane disintegration Not specified Not found Not found Not found