66 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp05971 | Ribosome-inactivating protein lyophyllin (EC 3.2.2.22) | ITFQGCSPARQTVITNAITRARADVRAAVSALPTKAPVSTFSTWFGVYND | Hon-shimeji | Cytotoxicity | MTT assay | Hela | Not found | IC50 : 358.8 μM |
| dbacp05972 | Ribosome-inactivating protein lyophyllin (EC 3.2.2.22) | ITFQGCSPARQTVITNAITRARADVRAAVSALPTKAPVSTFSTWFGVYND | Hon-shimeji | Cytotoxicity | MTT assay | HepG2 | Not found | IC50 : 489.8 μM |
| dbacp05973 | Ribosome-inactivating protein lyophyllin (EC 3.2.2.22) | ITFQGCSPARQTVITNAITRARADVRAAVSALPTKAPVSTFSTWFGVYND | Hon-shimeji | Cytotoxicity | MTT assay | JAR | Not found | IC50 : 926.9 μM |
| dbacp07021 | BmPLA2 | FKWQFEMLIMKIAKTSGFMFYSSY | phospholipase A2 isoform from B. moojeni venom | Membrane disruption, selective cancer cytotoxicity | MTT assay | CaCo-2 | Colorectal Cancer | IC50 = 0.6 µM |
| dbacp07022 | BmPLA2 | FKWQFEMLIMKIAKTSGFMFYSSY | phospholipase A2 isoform from B. moojeni venom | Membrane disruption, selective cancer cytotoxicity | MTT assay | RD | Rhabdomyosarcoma | 60% reduction in cell viability |
| dbacp07085 | HB43 | FAKLLAKLAKKLL | Synthetic | Motif-driven membrane insertion triggers cytotoxicity | AlamarBlue assay | SW-480 | Colon Cancer | IC50 = 12 ± 4 μM |
| dbacp07086 | HB43 | FAKLLAKLAKKLL | Synthetic | Motif-driven membrane insertion triggers cytotoxicity | AlamarBlue assay | SW-620 | Colon Cancer | IC50 = 10 ± 1 μM |
| dbacp07087 | HB43 | FAKLLAKLAKKLL | Synthetic | Motif-driven membrane insertion triggers cytotoxicity | AlamarBlue assay | HT-29 | Colon Cancer | IC50 = 11 ± 1 μM |
| dbacp07088 | HB43 | FAKLLAKLAKKLL | Synthetic | Motif-driven membrane insertion triggers cytotoxicity | AlamarBlue assay | MDA-MB-231 | Breast Cancer | 50% cell viability at 20 μM |
| dbacp07089 | HB43-mut2 | FAKLLAKLAKLLK | Synthetic | Motif-driven membrane insertion triggers cytotoxicity | AlamarBlue assay | SW-480 | Colon Cancer | IC50 = 34 ± 2 μM |
| dbacp07090 | HB43-mut2 | FAKLLAKLAKLLK | Synthetic | Motif-driven membrane insertion triggers cytotoxicity | AlamarBlue assay | SW-620 | Colon Cancer | IC50 = 40 ± 3 μM |
| dbacp07091 | HB43-mut2 | FAKLLAKLAKLLK | Synthetic | Motif-driven membrane insertion triggers cytotoxicity | AlamarBlue assay | HT-29 | Colon Cancer | IC50 = 50 ± 3 μM |
| dbacp07092 | HB43-mut2 | FAKLLAKLAKLLK | Synthetic | Motif-driven membrane insertion triggers cytotoxicity | AlamarBlue assay | MDA-MB-231 | Breast Cancer | 80% cell viability at 20 μM |
| dbacp07093 | HB43-mut3 | FAKLLAKLARRLL | Synthetic | Motif-driven membrane insertion triggers cytotoxicity | AlamarBlue assay | SW-480 | Colon Cancer | IC50 = 8 ± 1 μM |
| dbacp07094 | HB43-mut3 | FAKLLAKLARRLL | Synthetic | Motif-driven membrane insertion triggers cytotoxicity | AlamarBlue assay | SW-620 | Colon Cancer | IC50 = 9 ± 1 μM |
| dbacp07095 | HB43-mut3 | FAKLLAKLARRLL | Synthetic | Motif-driven membrane insertion triggers cytotoxicity | AlamarBlue assay | HT-29 | Colon Cancer | IC50 = 9 ± 1 μM |
| dbacp07096 | HB43-mut3 | FAKLLAKLARRLL | Synthetic | Motif-driven membrane insertion triggers cytotoxicity | AlamarBlue assay | MDA-MB-231 | Breast Cancer | 75% cell viability at 20 μM |
| dbacp07107 | Nigrocin-M1 | GLLGKILGAGKKVLLGVSGLL | Synthetic | Membrane disruption mediates selective cytotoxicity. | MTT assay | H-157 | Non-small cell lung cancer | IC50 = 24 μM |
| dbacp07108 | Nigrocin-M1 | GLLGKILGAGKKVLLGVSGLL | Synthetic | Membrane disruption mediates selective cytotoxicity. | MTT assay | PC-3 | Prostate cancer | IC50 = 31.27 μM |
| dbacp07109 | Nigrocin-M1 | GLLGKILGAGKKVLLGVSGLL | Synthetic | Membrane disruption mediates selective cytotoxicity. | MTT assay | U-251-MG | Brain Tumor | IC50 = 25.06 μM |
| dbacp07110 | Nigrocin-M1 | GLLGKILGAGKKVLLGVSGLL | Synthetic | Membrane disruption mediates selective cytotoxicity. | MTT assay | MCF-7 | Breast Cancer | IC50 = 24.60 μM |
| dbacp07865 | R-Lycosin I derivative 8a | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | MDA-MB-231 | Breast Cancer | IC50 = 10.1 ± 0.2 µM |
| dbacp07866 | R-Lycosin I derivative 8a | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | A-549 | Lung Cancer | IC50 = 9.6 ± 0.3 µM |
| dbacp07867 | R-Lycosin I derivative 8a | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | H-460 | Lung Cancer | IC50 = 8.5 ± 0.4 µM |
| dbacp07868 | R-Lycosin I derivative 8a | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | H-1437 | Lung Cancer | IC50 = 13.0 ± 0.2 µM |
| dbacp07869 | R-Lycosin I derivative 8a | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | HGC-27 | Gastric Cancer | IC50 = 12.6 ± 0.6 µM |
| dbacp07870 | R-Lycosin I derivative 8a | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | PC-3 | Prostate Cancer | IC50 = 6.9 ± 0.4 µM |
| dbacp07871 | R-Lycosin I derivative 8b | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | MDA-MB-231 | Breast Cancer | IC50 = 6.0 ± 0.2 µM |
| dbacp07872 | R-Lycosin I derivative 8b | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | A-549 | Lung Cancer | IC50 = 7.0 ± 0.3 µM |
| dbacp07873 | R-Lycosin I derivative 8b | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | H-460 | Lung Cancer | IC50 = 4.9 ± 0.9 µM |
| dbacp07874 | R-Lycosin I derivative 8b | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | H-1437 | Lung Cancer | IC50 = 5.3 ± 0.2 µM |
| dbacp07875 | R-Lycosin I derivative 8b | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | HGC-27 | Gastric Cancer | IC50 = 5.3 ± 0.2 µM |
| dbacp07876 | R-Lycosin I derivative 8b | RGWFRAMRSIARFIARERLRGHL | Monosaccharide Analogue of Anticancer Peptide R-Lycosin-I | GLUT1-mediated uptake enhances cytotoxicity | CCK-8 assay | PC-3 | Prostate Cancer | IC50 = 4.9 ± 0.2 µM |
| dbacp07925 | oligopeptide 1 | AGAPGG | Sarcophyton glaucum | Selective cytotoxicity, DNA damage, apoptosis | MTT assay | HeLa | Cervical Cancer | EC50 = 8.6 mmol/L |
| dbacp07926 | Phylloseptin-PBa3 | FLSLIPHIVSGVAALANHL | Phyllomedusa burmeisteri | Membrane disruption, apoptosis, selective cytotoxicity | MTT assay | MDA-MB-435S | Breast Cancer | IC50 = 208 µM |
| dbacp07927 | Phylloseptin-PBa3 | FLSLIPHIVSGVAALANHL | Phyllomedusa burmeisteri | Membrane disruption, apoptosis, selective cytotoxicity | MTT assay | H-838 | Lung Cancer | Cell viability ~ 65% at 10-5 M |
| dbacp07956 | DP-2 | GRKKRRQRRRGALWKSLLKNVGKA | Synthetic | DRS-DU-1 induces selective tumor cytotoxicity | MTT assay | H-157 | Lung Cancer | IC50 = 3.21 μM |
| dbacp07957 | DP-2 | GRKKRRQRRRGALWKSLLKNVGKA | Synthetic | DRS-DU-1 induces selective tumor cytotoxicity | MTT assay | PC-3 | Prostate Cancer | IC50 = 6.75 μM |
| dbacp07989 | K5, 17-DPS3 | ALWKKILKNAGKAALNKINQIVQ | Analogue of Dermaseptin-PS3 | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | H-157 | Lung Cancer | IC50 = 18.20 μM |
| dbacp07990 | K5, 17-DPS3 | ALWKKILKNAGKAALNKINQIVQ | Analogue of Dermaseptin-PS3 | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | PC-3 | Prostate Cancer | IC50 = 18.20 μM |
| dbacp07991 | L10, 11-DPS3 | ALWKDILKNLLKAALNEINQIVQ | Analogue of Dermaseptin-PS3 | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | H-157 | Lung Cancer | IC50 = 0.12 μM |
| dbacp07992 | L10, 11-DPS3 | ALWKDILKNLLKAALNEINQIVQ | Analogue of Dermaseptin-PS3 | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | PC-3 | Prostate Cancer | IC50 = 1.85 μM |
| dbacp07993 | [G10a]SHa | FLSGIVGMLaKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | MCF-7 | Breast Cancer | IC50 = 16.2 ± 2.2 µM |
| dbacp07994 | [G10a]SHa | FLSGIVGMLaKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | HeLa | Cervical Cancer | IC50 = 22.7 ± 0.86 µM |
| dbacp07995 | [G10a]SHa | FLSGIVGMLaKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | NCI-H-460 | Lung Cancer | IC50 =24.3 ± 0.8 µM |
| dbacp07996 | [G10a]SHa-BCTP | FLSGIVGMLaKLFLFKQYAELW | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | MCF-7 | Breast Cancer | IC50 = 26.85 ± 1.85 µM |
| dbacp07997 | [G10a]SHa-BCTP | FLSGIVGMLaKLFLFKQYAELW | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | HeLa | Cervical Cancer | IC50 >100 µM |
| dbacp07998 | [G10a]SHa-BCTP | FLSGIVGMLaKLFLFKQYAELW | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | NCI-H-460 | Lung Cancer | IC50 >100 µM |
| dbacp07999 | [G4a]SHa | FLSaIVGMLGKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | MCF-7 | Breast Cancer | IC50 = 17.9 ± 1.1 µM |
| dbacp08000 | [G4a]SHa | FLSaIVGMLGKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | HeLa | Cervical Cancer | IC50 >100 µM |
| dbacp08001 | [G4a]SHa | FLSaIVGMLGKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | NCI-H-460 | Lung Cancer | IC50 >100 µM |
| dbacp08002 | [G7a]SHa | FLSGIVaMLGKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | MCF-7 | Breast Cancer | IC50 =22.4 ± 2.2 µM |
| dbacp08003 | [G7a]SHa | FLSGIVaMLGKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | HeLa | Cervical Cancer | IC50 >100 µM |
| dbacp08004 | [G7a]SHa | FLSGIVaMLGKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | NCI-H-460 | Lung Cancer | IC50 >100 µM |
| dbacp08005 | [G4,7a]SHa | FLSaIVaMLGKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | MCF-7 | Breast Cancer | IC50 = 29.5 ± 6.03 µM |
| dbacp08006 | [G4,7a]SHa | FLSaIVaMLGKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | HeLa | Cervical Cancer | IC50 >100 µM |
| dbacp08007 | [G4,7a]SHa | FLSaIVaMLGKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | NCI-H-460 | Lung Cancer | IC50 = 37.3 ± 3.5 µM |
| dbacp08008 | [G4,7,10a]SHa | FLSaIVaMLaKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | MCF-7 | Breast Cancer | IC50 = 26.33 ± 5.8 µM |
| dbacp08009 | [G4,7,10a]SHa | FLSaIVaMLaKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | HeLa | Cervical Cancer | IC50 >100 µM |
| dbacp08010 | [G4,7,10a]SHa | FLSaIVaMLaKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | NCI-H-460 | Lung Cancer | IC50 >100 µM |
| dbacp08011 | [G7,10a]SHa | FLSGIVaMLaKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | MCF-7 | Breast Cancer | IC50 = 21.3 ± 1.13 µM |
| dbacp08012 | [G7,10a]SHa | FLSGIVaMLaKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | HeLa | Cervical Cancer | IC50 >100 µM |
| dbacp08013 | [G7,10a]SHa | FLSGIVaMLaKLF | Synthetic analogue of Temporin-1SHa | Enhanced cationicity/hydrophobicity increases cytotoxicity | MTT assay | NCI-H-460 | Lung Cancer | IC50 >100 µM |
| dbacp08052 | Poca A | GLPCAESCVFIPCTITAILGCSCRDRVCYD | Pombalia calceolaria | Cyclotides induce cytotoxicity, inhibit migration | MTS assay | MDA-MB-231 | Breast Cancer | IC50 = 1.8 μM |
| dbacp08053 | Poca B | GIPCAESCVFIPCVTAILGCSCKDVCYN | Pombalia calceolaria | Cyclotides induce cytotoxicity, inhibit migration | MTS assay | MDA-MB-231 | Breast Cancer | IC50 = 2.7 μM |
| dbacp08054 | CyO4 | GIPCGESCVWIPCISSAIGCSCKNKVCYRN | Viola odorata | Cyclotides induce cytotoxicity, inhibit migration | MTS assay | MDA-MB-231 | Breast Cancer | IC50 = 9.8 μM |