dbACP: A Comprehensive Database of Anti-Cancer Peptides

5 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp05218 PE-BBI GALKGCWTKSIPPKPC Edible frog Cell membrane permeabilisation MTT assay DKS8 Human colorectal cancer IC50 : 9.8 µM
dbacp08021 Peptide4 Gonearrestide ADAPGNYPLDARGKSYYC Androctonus australis Gonearrestide induces G1 cell-cycle arrest MTT assay Dks8 Colon Cancer Not Available
dbacp08026 Peptide6 Gonearrestide KLSAIISKIRDE Androctonus australis Gonearrestide induces G1 cell-cycle arrest MTT assay Dks8 Colon Cancer Not Available
dbacp08031 Peptide10 Gonearrestide NDADKDEMQSVYRGKANDDNSRGSKTNHRF Androctonus mauritanicus Gonearrestide induces G1 cell-cycle arrest MTT assay Dks8 Colon Cancer Not Available
dbacp08036 Peptide13 Gonearrestide WCYKLPDRVSIKEKGRCN Androctonus mauritanicus Gonearrestide induces G1 cell-cycle arrest MTT assay Dks8 Colon Cancer Not Available