dbACP: A Comprehensive Database of Anti-Cancer Peptides

4 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02344 Cecropin A RWKLFKKIEKVGRNVRDGLIKAGPAIAVIGQAKSL Silkworm, Domestic silk moth Not specified Not specified Not found Not found Not found
dbacp02375 CecropinXJ RWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKAIGK Larvae, Domestic silk moth Disruption of cell membrane Not specified Not found Not found Not found
dbacp02376 CecropinXJ (Insects, arthropods, invertebrates, animals) RWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKAIGK Domestic silk moth Not specified Not specified Not found Not found Not found
dbacp02378 Cercopin D GNFFKDLEKMGQRVRDAVISAAPAVDTLAKAKALGQ Domestic silk moth Apoptosis inducing Not specified Not found Not found Not found