dbACP: A Comprehensive Database of Anti-Cancer Peptides

2 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp05130 Pal-pFL-N-Ter-TAT FPWWWPFLRDVFTKGYGFGLGRKKRRQRRRPQ VDAC1(voltage-dependent anion channel1) Inducing apoptosis MTT assay A375 Leukemia IC50 : 5.5 ± 1.1 μM
dbacp05490 PFL-N-Ter-TAT FPWWWPFLRDVFTKGYGFGLGRKKRRQRRRPQ VDAC1 Inducing apoptosis SRB assay A375 Human endometrial cancer IC50 : 5.5 ± 1.1 μM