2 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp02631 | DC1 | GAFLKCGESCVYLPCLTTVVGCSCQNSVCYRD | Snake-needle grass | Apoptosis inducing | Colorimetric Cell viability assay,Migration assay ,Wound healing assay and Human prostate cancer xenograft assay | DC3 | Prostate cancer | Not found |
| dbacp02632 | DC1 | GAFLKCGESCVYLPCLTTVVGCSCQNSVCYRD | Snake-needle grass | Apoptosis inducing | Colorimetric Cell viability assay,Migration assay ,Wound healing assay and Human prostate cancer xenograft assay | LNCap | Prostate cancer | Not found |