dbACP: A Comprehensive Database of Anti-Cancer Peptides

3 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02521 Cliotide T2 GEFLKCGESCVQGECYTPGCSCDWPICKKN Butterfly pea Not specified Not specified Not found Not found Not found
dbacp02522 Cliotide T2 GEFLKCGESCVQGECYTPGCSCDWPICKKN Butterfly pea Not specified Not specified Not found Not found Not found
dbacp02523 Cliotide T2 (cT2; Plant defensin) GEFLKCGESCVQGECYTPGCSCDWPICKKN Butterfly pea Not specified MTT assay HeLa cells Not found IC50 : 8.0 µM