dbACP: A Comprehensive Database of Anti-Cancer Peptides

1 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02593 Cupiennin 1a GFGALFKFLAKKVAKTVAKQAAKQGAKYVVNKQME Not found Membrane destroying mode of action on prokaryotic as well as eukaryotic cells Not specified Not found Not found Not found