3 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp02436 | ChaC2 | GIPCAESCVWIPPCTITALMGCSCKNNVCYNN | Beras-beras | Permeabilization of the lipid membrane of the target cells | Not specified | Not found | Not found | Not found |
| dbacp02437 | ChaC2 (Chassatide C2; Plant defensin) | GIPCAESCVWIPPCTITALMGCSCKNNVCYNN | Beras-beras | Not specified | MTT assay | HeLa cells | Not found | IC50 : 2.4 µM |
| dbacp02461 | Chassatide C2 | GIPCAESCVWIPPCTITALMGCSCKNNVCYNN | Beras-beras | Permeabilization of the lipid membrane of the target cells | Not specified | Not found | Not found | Not found |