dbACP: A Comprehensive Database of Anti-Cancer Peptides

3 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02436 ChaC2 GIPCAESCVWIPPCTITALMGCSCKNNVCYNN Beras-beras Permeabilization of the lipid membrane of the target cells Not specified Not found Not found Not found
dbacp02437 ChaC2 (Chassatide C2; Plant defensin) GIPCAESCVWIPPCTITALMGCSCKNNVCYNN Beras-beras Not specified MTT assay HeLa cells Not found IC50 : 2.4 µM
dbacp02461 Chassatide C2 GIPCAESCVWIPPCTITALMGCSCKNNVCYNN Beras-beras Permeabilization of the lipid membrane of the target cells Not specified Not found Not found Not found