dbACP: A Comprehensive Database of Anti-Cancer Peptides

3 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02517 Cliotide T1 (cT1; Plant defensin) GIPCGESCVFIPCITAAIGCSCKSKVCYRN Butterfly pea Not specified MTT assay HeLa cells Not found IC50 : 0.6 µM
dbacp02527 Cliotide T4 GIPCGESCVFIPCITAAIGCSCKSKVCYRN Butterfly pea Not specified Not specified Not found Not found Not found
dbacp02528 Cliotide T4 GIPCGESCVFIPCITAAIGCSCKSKVCYRN Butterfly pea Not specified Not specified Not found Not found Not found