dbACP: A Comprehensive Database of Anti-Cancer Peptides

3 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02515 Cliotide T1 GIPCGESCVFIPCITGAIGCSCKSKVCYRN Butterfly pea Not specified Not specified Not found Not found Not found
dbacp02516 Cliotide T1 GIPCGESCVFIPCITGAIGCSCKSKVCYRN Butterfly pea Not specified Not specified Not found Not found Not found
dbacp02529 Cliotide T4 (cT4; Plant defensin) GIPCGESCVFIPCITGAIGCSCKSKVCYRN Butterfly pea Not specified MTT assay HeLa cells Not found IC50 : 0.6 µM