dbACP: A Comprehensive Database of Anti-Cancer Peptides

3 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp04702 Mram 8 GIPCGESCVFIPCLTSAIDCSCKSKVCYRN Chinese Violet herb Not specified Not specified Not found Not found Not found
dbacp04703 Mram 8 GIPCGESCVFIPCLTSAIDCSCKSKVCYRN Chinese Violet herb Not specified Not specified Not found Not found Not found
dbacp04704 Mram 8 GIPCGESCVFIPCLTSAIDCSCKSKVCYRN Chinese Violet herb Not specified Not specified Not found Not found Not found