dbACP: A Comprehensive Database of Anti-Cancer Peptides

2 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02600 Cycloviolacin O2 GIPCGESCVWIPCISSAIGCSCKSKVCYRN Not found Cell membrane disintegration Not specified Not found Not found Not found
dbacp02601 Cycloviolacin O2 GIPCGESCVWIPCISSAIGCSCKSKVCYRN Not found Cell membrane disintegration Not specified Not found Not found Not found