dbACP: A Comprehensive Database of Anti-Cancer Peptides

2 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp01159 Antimicrobial peptide NK-lysin GLICESCRKIIQKLEDMVGPQPNEDTVTQAASRVCDKMKILRGVCKKIMRTFLRRISKDILTGKKPQAICVDIKICKE Pig Not specified Not specified Not found Not found Not found
dbacp05623 Porcine NK-Lysin GLICESCRKIIQKLEDMVGPQPNEDTVTQAASRVCDKMKILRGVCKKIMRTFLRRISKDILTGKKPQAICVDIKICKE Cytotoxic T and NK cells, small intestine, domestic pig Forms lytic pores in the target cell membrane Not specified Not found Not found Not found