dbACP: A Comprehensive Database of Anti-Cancer Peptides

3 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp06510 Viphi F GSIPCGESCVFIPCISAIIGCSCSSKVCYKN Chinese Violet herb Not specified Not specified Not found Not found Not found
dbacp06511 Viphi F GSIPCGESCVFIPCISAIIGCSCSSKVCYKN Chinese Violet herb Not specified Not specified Not found Not found Not found
dbacp06512 Viphi F GSIPCGESCVFIPCISAIIGCSCSSKVCYKN Chinese Violet herb Not specified Not specified Not found Not found Not found