dbACP: A Comprehensive Database of Anti-Cancer Peptides

3 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp06502 Viphi A GSIPCGESCVFIPCISSVIGCACKSKVCYKN Chinese Violet herb Not specified Not specified Not found Not found Not found
dbacp06503 Viphi A GSIPCGESCVFIPCISSVIGCACKSKVCYKN Chinese Violet herb Not specified Not specified Not found Not found Not found
dbacp06509 Viphi F GSIPCGESCVFIPCISSVIGCACKSKVCYKN Chinese Violet herb Not specified Not specified Not found Not found Not found