53 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp01238 | Aurein 1.1 | GLFDIIKKIAESI | Green and Golden Bell Frog, Australia | Cell membrane disintegration | Not specified | Not found | Not found | Not found |
| dbacp01239 | Aurein 1.2 | GLFDIIKKIAESF | Southern bell frog Green and Golden Bell Frog, Australia | Cell membrane penetration | Not specified | Not specified | Not specified | LC50 : 10⁻⁵ to 10⁻⁴ M |
| dbacp01243 | Aurein 2.2 | GLFDIVKKVVGALGSL | Green and Golden Bell Frog, Australia | Cell membrane penetration | Not specified | Not found | Not found | Not found |
| dbacp01245 | Aurein 2.3 | GLFDIVKKVVGAIGSL | Green and Golden Bell Frog, Australia | Cell membrane penetration | Not specified | Not found | Not found | Not found |
| dbacp01247 | Aurein 2.4 | GLFDIVKKVVGTLAGL | Green and Golden Bell Frog, Australia | Cell membrane penetration | Not specified | Not found | Not found | Not found |
| dbacp01303 | Aurein-2.1 [Cleaved into: Aurein-2.1.1] | GLLDIVKKVVGAFGSL | Green and golden bell frog | Cell membrane disintegration | Not specified | Not specified | Not specified | LC50 : 10⁻⁵ to 10⁻⁴ M |
| dbacp01305 | Aurein-2.2 [Cleaved into: Aurein-2.2.1] | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGALGSLGKRNDLE | Green and golden bell frog | Membrane disruption | Not specified | Human tumour cell lines | Colorectal cancer | LC50 : 10-5 - 10-4 M |
| dbacp01306 | Aurein-2.3 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNGEDEDENEAANHEEGSEEKRGLFDIVKKVVGAIGSLGKRNDVE | Green and golden bell frog | Membrane disruption | Not specified | Human tumour cell lines | Prostate cancer | LC50 : 10-5 - 10-4 M |
| dbacp01309 | Aurein-2.4 [Cleaved into: Aurein-2.4.1] | GLFDIVKKVVGTIAGL | Green and golden bell frog | Cell membrane disintegration | Not specified | Not found | Not found | Not found |
| dbacp01310 | Aurein-2.4 [Cleaved into: Aurein-2.4.1] | GLFDIVKKVVGTIAGL | Green and golden bell frog | Cell membrane disintegration | Not specified | Not specified | Not specified | LC50 : 10-5 - 10-4 M |
| dbacp01311 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Not specified | Not specified | Not found | Leukaemia | Not found |
| dbacp01312 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Not specified | Not specified | Not found | Lung cancer | Not found |
| dbacp01313 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Not specified | Not specified | Not found | Colon cancer | Not found |
| dbacp01314 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Not specified | Not specified | Not found | CNS | Not found |
| dbacp01315 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Not specified | Not specified | Not found | Skin cancer | Not found |
| dbacp01316 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Not specified | Not specified | Not found | Ovarian cancer | Not found |
| dbacp01317 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Not specified | Not specified | Not found | Renal cancer | Not found |
| dbacp01318 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Not specified | Not specified | Not found | Prostate cancer | Not found |
| dbacp01319 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Not specified | Not specified | Not found | Breast cancer | Not found |
| dbacp01320 | Aurein-2.5 | GLFDIVKKVVGAFGSL | Green and golden bell frog | Not specified | Not specified | Not found | Leukaemia | Not found |
| dbacp01321 | Aurein-2.5 | GLFDIVKKVVGAFGSL | Green and golden bell frog | Not specified | Not specified | Not found | Lung cancer | Not found |
| dbacp01322 | Aurein-2.5 | GLFDIVKKVVGAFGSL | Green and golden bell frog | Not specified | Not specified | Not found | Colon cancer | Not found |
| dbacp01323 | Aurein-2.5 | GLFDIVKKVVGAFGSL | Green and golden bell frog | Not specified | Not specified | Not found | CNS | Not found |
| dbacp01324 | Aurein-2.5 | GLFDIVKKVVGAFGSL | Green and golden bell frog | Not specified | Not specified | Not found | Skin cancer | Not found |
| dbacp01325 | Aurein-2.5 | GLFDIVKKVVGAFGSL | Green and golden bell frog | Not specified | Not specified | Not found | Ovarian cancer | Not found |
| dbacp01326 | Aurein-2.5 | GLFDIVKKVVGAFGSL | Green and golden bell frog | Not specified | Not specified | Not found | Renal cancer | Not found |
| dbacp01327 | Aurein-2.5 | GLFDIVKKVVGAFGSL | Green and golden bell frog | Not specified | Not specified | Not found | Prostate cancer | Not found |
| dbacp01328 | Aurein-2.5 | GLFDIVKKVVGAFGSL | Green and golden bell frog | Not specified | Not specified | Not found | Breast cancer | Not found |
| dbacp01329 | Aurein-2.5 | GLFDIVKKVVGAFGSL | Green and golden bell frog | Cell membrane disintegration | One-dose and five-dose assay | K-562 | Leukemia | IC50 : 4-5 μM |
| dbacp01330 | Aurein-2.5 | GLFDIVKKVVGAFGSL | Green and golden bell frog | Cell membrane disintegration | One-dose and five-dose assay | HOP-92 | Lung cancer | IC50 : 5 μM |
| dbacp01331 | Aurein-2.5 | GLFDIVKKVVGAFGSL | Green and golden bell frog | Cell membrane disintegration | One-dose and five-dose assay | HCT-116 | Colon cancer | IC50 : 4-5 μM |
| dbacp01332 | Aurein-2.5 | GLFDIVKKVVGAFGSL | Green and golden bell frog | Cell membrane disintegration | One-dose and five-dose assay | SNB-19 | CNS cancer | IC50 : 5 μM |
| dbacp01333 | Aurein-2.5 | GLFDIVKKVVGAFGSL | Green and golden bell frog | Cell membrane disintegration | One-dose and five-dose assay | M14 | Melanoma | IC50 : 5 μM |
| dbacp01334 | Aurein-2.5 | GLFDIVKKVVGAFGSL | Green and golden bell frog | Cell membrane disintegration | One-dose and five-dose assay | OVCAR-5 | Ovarian cancer | IC50 : 5 μM |
| dbacp01335 | Aurein-2.5 | GLFDIVKKVVGAFGSL | Green and golden bell frog | Cell membrane disintegration | One-dose and five-dose assay | ACHN | Renal cancer | IC50 : 5 μM |
| dbacp01336 | Aurein-2.5 | GLFDIVKKVVGAFGSL | Green and golden bell frog | Cell membrane disintegration | One-dose and five-dose assay | Not found | Prostate cancer | IC50 : 5 μM |
| dbacp01337 | Aurein-2.5 | GLFDIVKKVVGAFGSL | Green and golden bell frog | Cell membrane disintegration | One-dose and five-dose assay | HS 578T | Breast cancer | IC50 : 5 μM |
| dbacp01338 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Membrane disruption | Not specified | Human tumour cell lines | Leukaemia | LC50 : 10-5 - 10-4 M |
| dbacp01339 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Membrane disruption | Not specified | Human tumour cell lines | Lung cancer | LC50 : 10-5 - 10-4 M |
| dbacp01340 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Membrane disruption | Not specified | Human tumour cell lines | Colon cancer | LC50 : 10-5 - 10-4 M |
| dbacp01341 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Membrane disruption | Not specified | Human tumour cell lines | Prostate cancer | LC50 : 10-5 - 10-4 M |
| dbacp01342 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Membrane disruption | Not specified | Human tumour cell lines | Breast cancer | LC50 : 10-5 - 10-4 M |
| dbacp01343 | Aurein-2.5 | GLFDIVKKVVGAFGSL | Green and golden bell frog | Membrane disruption | Not specified | Human tumour cell lines | Leukaemia | LC50 : 10-5 - 10-4 M |
| dbacp01367 | Aurein-3.1 [Cleaved into: Aurein-3.1.1; Aurein-3.1.2] | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKIAGHIAGSIGKKR | Green and golden bell frog | Membrane disruption | Not specified | Human tumour cell lines | Lung cancer | LC50 : 10-5 - 10-4 M |
| dbacp01369 | Aurein-3.1.1 | GLFDIVKKIAGHIA | Green and golden bell frog | Cell membrane disintegration | Not specified | Not found | Not found | Not found |
| dbacp01370 | Aurein-3.1.2 | FDIVKKIAGHIAGSI | Green and golden bell frog | Cell membrane disintegration | Not specified | Not found | Not found | Not found |
| dbacp01381 | Aurein-3.2 | GLFDIVKKIAGHIASSI | Green and golden bell frog | Cell membrane disintegration | Not specified | Not specified | Not specified | LC50 : 10⁻⁵ - 10⁻⁴ M |
| dbacp01394 | Aurein-4.1 | GLIQTIKEKLKELAGGLVTGIQS | Green and golden bell frog | Cell membrane disintegration | Not specified | Not specified | Not specified | LC50 : 10⁻⁵ - 10⁻⁴ M |
| dbacp01396 | Aurein-4.2 | GLLQTIKEKLKEFAGGVVTGVQS | Green and golden bell frog | Cell membrane disintegration | Not specified | Not specified | Not specified | LC50 : 10⁻⁵ - 10⁻⁴ M |
| dbacp01397 | Aurein-4.3 | GLLQTITEKLKEFAGGLVTGVQS | Green and golden bell frog | Cell membrane disintegration | Not specified | Not specified | Not specified | LC50 : 10⁻⁵ - 10⁻⁴ M |
| dbacp01399 | Aurein-4.4 | GLLQTIKEKLKELATGLVIGVQS | Green and golden bell frog | Cell membrane disintegration | Not specified | Not specified | Not specified | LC50 : 10⁻⁵ - 10⁻⁴ M |
| dbacp01401 | Aurein-5.1 | GLLDIVTGLLGNLIVDVLKPKTPAS | Green and golden bell frog | Cell membrane disintegration | Not specified | Not specified | Not specified | LC50 : 10⁻⁵ - 10⁻⁴ M |
| dbacp01403 | Aurein-5.3 | MAFLKKSLFLVLFLGLVSLSICEQEKREEENQEEDEENEAASEEKRGLMSSIGKALGGLIVDVLKPKTPAS | Green and golden bell frog | Cell membrane disintegration | Not specified | Not specified | Not specified | LC50 : 10⁻⁵ - 10⁻⁴ M |