dbACP: A Comprehensive Database of Anti-Cancer Peptides

53 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp01238 Aurein 1.1 GLFDIIKKIAESI Green and Golden Bell Frog, Australia Cell membrane disintegration Not specified Not found Not found Not found
dbacp01239 Aurein 1.2 GLFDIIKKIAESF Southern bell frog Green and Golden Bell Frog, Australia Cell membrane penetration Not specified Not specified Not specified LC50 : 10⁻⁵ to 10⁻⁴ M
dbacp01243 Aurein 2.2 GLFDIVKKVVGALGSL Green and Golden Bell Frog, Australia Cell membrane penetration Not specified Not found Not found Not found
dbacp01245 Aurein 2.3 GLFDIVKKVVGAIGSL Green and Golden Bell Frog, Australia Cell membrane penetration Not specified Not found Not found Not found
dbacp01247 Aurein 2.4 GLFDIVKKVVGTLAGL Green and Golden Bell Frog, Australia Cell membrane penetration Not specified Not found Not found Not found
dbacp01303 Aurein-2.1 [Cleaved into: Aurein-2.1.1] GLLDIVKKVVGAFGSL Green and golden bell frog Cell membrane disintegration Not specified Not specified Not specified LC50 : 10⁻⁵ to 10⁻⁴ M
dbacp01305 Aurein-2.2 [Cleaved into: Aurein-2.2.1] MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGALGSLGKRNDLE Green and golden bell frog Membrane disruption Not specified Human tumour cell lines Colorectal cancer LC50 : 10-5 - 10-4 M
dbacp01306 Aurein-2.3 MAFLKKSLFLVLFLGLVSLSICEKEKRQNGEDEDENEAANHEEGSEEKRGLFDIVKKVVGAIGSLGKRNDVE Green and golden bell frog Membrane disruption Not specified Human tumour cell lines Prostate cancer LC50 : 10-5 - 10-4 M
dbacp01309 Aurein-2.4 [Cleaved into: Aurein-2.4.1] GLFDIVKKVVGTIAGL Green and golden bell frog Cell membrane disintegration Not specified Not found Not found Not found
dbacp01310 Aurein-2.4 [Cleaved into: Aurein-2.4.1] GLFDIVKKVVGTIAGL Green and golden bell frog Cell membrane disintegration Not specified Not specified Not specified LC50 : 10-5 - 10-4 M
dbacp01311 Aurein-2.5 MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE Green and golden bell frog Not specified Not specified Not found Leukaemia Not found
dbacp01312 Aurein-2.5 MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE Green and golden bell frog Not specified Not specified Not found Lung cancer Not found
dbacp01313 Aurein-2.5 MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE Green and golden bell frog Not specified Not specified Not found Colon cancer Not found
dbacp01314 Aurein-2.5 MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE Green and golden bell frog Not specified Not specified Not found CNS Not found
dbacp01315 Aurein-2.5 MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE Green and golden bell frog Not specified Not specified Not found Skin cancer Not found
dbacp01316 Aurein-2.5 MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE Green and golden bell frog Not specified Not specified Not found Ovarian cancer Not found
dbacp01317 Aurein-2.5 MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE Green and golden bell frog Not specified Not specified Not found Renal cancer Not found
dbacp01318 Aurein-2.5 MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE Green and golden bell frog Not specified Not specified Not found Prostate cancer Not found
dbacp01319 Aurein-2.5 MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE Green and golden bell frog Not specified Not specified Not found Breast cancer Not found
dbacp01320 Aurein-2.5 GLFDIVKKVVGAFGSL Green and golden bell frog Not specified Not specified Not found Leukaemia Not found
dbacp01321 Aurein-2.5 GLFDIVKKVVGAFGSL Green and golden bell frog Not specified Not specified Not found Lung cancer Not found
dbacp01322 Aurein-2.5 GLFDIVKKVVGAFGSL Green and golden bell frog Not specified Not specified Not found Colon cancer Not found
dbacp01323 Aurein-2.5 GLFDIVKKVVGAFGSL Green and golden bell frog Not specified Not specified Not found CNS Not found
dbacp01324 Aurein-2.5 GLFDIVKKVVGAFGSL Green and golden bell frog Not specified Not specified Not found Skin cancer Not found
dbacp01325 Aurein-2.5 GLFDIVKKVVGAFGSL Green and golden bell frog Not specified Not specified Not found Ovarian cancer Not found
dbacp01326 Aurein-2.5 GLFDIVKKVVGAFGSL Green and golden bell frog Not specified Not specified Not found Renal cancer Not found
dbacp01327 Aurein-2.5 GLFDIVKKVVGAFGSL Green and golden bell frog Not specified Not specified Not found Prostate cancer Not found
dbacp01328 Aurein-2.5 GLFDIVKKVVGAFGSL Green and golden bell frog Not specified Not specified Not found Breast cancer Not found
dbacp01329 Aurein-2.5 GLFDIVKKVVGAFGSL Green and golden bell frog Cell membrane disintegration One-dose and five-dose assay K-562 Leukemia IC50 : 4-5 μM
dbacp01330 Aurein-2.5 GLFDIVKKVVGAFGSL Green and golden bell frog Cell membrane disintegration One-dose and five-dose assay HOP-92 Lung cancer IC50 : 5 μM
dbacp01331 Aurein-2.5 GLFDIVKKVVGAFGSL Green and golden bell frog Cell membrane disintegration One-dose and five-dose assay HCT-116 Colon cancer IC50 : 4-5 μM
dbacp01332 Aurein-2.5 GLFDIVKKVVGAFGSL Green and golden bell frog Cell membrane disintegration One-dose and five-dose assay SNB-19 CNS cancer IC50 : 5 μM
dbacp01333 Aurein-2.5 GLFDIVKKVVGAFGSL Green and golden bell frog Cell membrane disintegration One-dose and five-dose assay M14 Melanoma IC50 : 5 μM
dbacp01334 Aurein-2.5 GLFDIVKKVVGAFGSL Green and golden bell frog Cell membrane disintegration One-dose and five-dose assay OVCAR-5 Ovarian cancer IC50 : 5 μM
dbacp01335 Aurein-2.5 GLFDIVKKVVGAFGSL Green and golden bell frog Cell membrane disintegration One-dose and five-dose assay ACHN Renal cancer IC50 : 5 μM
dbacp01336 Aurein-2.5 GLFDIVKKVVGAFGSL Green and golden bell frog Cell membrane disintegration One-dose and five-dose assay Not found Prostate cancer IC50 : 5 μM
dbacp01337 Aurein-2.5 GLFDIVKKVVGAFGSL Green and golden bell frog Cell membrane disintegration One-dose and five-dose assay HS 578T Breast cancer IC50 : 5 μM
dbacp01338 Aurein-2.5 MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE Green and golden bell frog Membrane disruption Not specified Human tumour cell lines Leukaemia LC50 : 10-5 - 10-4 M
dbacp01339 Aurein-2.5 MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE Green and golden bell frog Membrane disruption Not specified Human tumour cell lines Lung cancer LC50 : 10-5 - 10-4 M
dbacp01340 Aurein-2.5 MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE Green and golden bell frog Membrane disruption Not specified Human tumour cell lines Colon cancer LC50 : 10-5 - 10-4 M
dbacp01341 Aurein-2.5 MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE Green and golden bell frog Membrane disruption Not specified Human tumour cell lines Prostate cancer LC50 : 10-5 - 10-4 M
dbacp01342 Aurein-2.5 MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE Green and golden bell frog Membrane disruption Not specified Human tumour cell lines Breast cancer LC50 : 10-5 - 10-4 M
dbacp01343 Aurein-2.5 GLFDIVKKVVGAFGSL Green and golden bell frog Membrane disruption Not specified Human tumour cell lines Leukaemia LC50 : 10-5 - 10-4 M
dbacp01367 Aurein-3.1 [Cleaved into: Aurein-3.1.1; Aurein-3.1.2] MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKIAGHIAGSIGKKR Green and golden bell frog Membrane disruption Not specified Human tumour cell lines Lung cancer LC50 : 10-5 - 10-4 M
dbacp01369 Aurein-3.1.1 GLFDIVKKIAGHIA Green and golden bell frog Cell membrane disintegration Not specified Not found Not found Not found
dbacp01370 Aurein-3.1.2 FDIVKKIAGHIAGSI Green and golden bell frog Cell membrane disintegration Not specified Not found Not found Not found
dbacp01381 Aurein-3.2 GLFDIVKKIAGHIASSI Green and golden bell frog Cell membrane disintegration Not specified Not specified Not specified LC50 : 10⁻⁵ - 10⁻⁴ M
dbacp01394 Aurein-4.1 GLIQTIKEKLKELAGGLVTGIQS Green and golden bell frog Cell membrane disintegration Not specified Not specified Not specified LC50 : 10⁻⁵ - 10⁻⁴ M
dbacp01396 Aurein-4.2 GLLQTIKEKLKEFAGGVVTGVQS Green and golden bell frog Cell membrane disintegration Not specified Not specified Not specified LC50 : 10⁻⁵ - 10⁻⁴ M
dbacp01397 Aurein-4.3 GLLQTITEKLKEFAGGLVTGVQS Green and golden bell frog Cell membrane disintegration Not specified Not specified Not specified LC50 : 10⁻⁵ - 10⁻⁴ M
dbacp01399 Aurein-4.4 GLLQTIKEKLKELATGLVIGVQS Green and golden bell frog Cell membrane disintegration Not specified Not specified Not specified LC50 : 10⁻⁵ - 10⁻⁴ M
dbacp01401 Aurein-5.1 GLLDIVTGLLGNLIVDVLKPKTPAS Green and golden bell frog Cell membrane disintegration Not specified Not specified Not specified LC50 : 10⁻⁵ - 10⁻⁴ M
dbacp01403 Aurein-5.3 MAFLKKSLFLVLFLGLVSLSICEQEKREEENQEEDEENEAASEEKRGLMSSIGKALGGLIVDVLKPKTPAS Green and golden bell frog Cell membrane disintegration Not specified Not specified Not specified LC50 : 10⁻⁵ - 10⁻⁴ M