63 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp01160 | Antimicrobial peptide TsAP-1 | MQIKHLITLFFLVLIVADQCSAFLSLIPSLVGGSISAFKGRRKREISAQIEQYKDLQKREAELEELLDRLPMY | Brazilian scorpion | Membrane disruption | MTT Cell viability assay | NCIeH157 | Human squamous carcinoma | IC50 : 0.83 - 2.0 μM |
| dbacp01166 | Antimicrobial peptide TsAP- | MQIKHLITLFFLVLIVADQCSAFLSLIPSLVGGSISAFKGRRKREISAQIEQYKDLQKREAELEELLDRLPMY | Brazilian scorpion | Antiproliferative action | Not specified | H157 | Prostate cancer | IC50 : 52.5 μM |
| dbacp01168 | Antimicrobial peptide TsAP-2 | MQIKHLITIFFLVLIVADHCHAFLGMIPGLIGGLISAFKGRRKREITSQIEQYRNLQKREAELENLLANLPVY | Brazilian scorpion | Antiproliferative activity | Not specified | H157 | Prostate cancer | IC50 : 4.1 μM |
| dbacp01941 | Brevinin-1H | FALGAVTKVLPKLFCLITRKC | Hainan Torrent Frog | Membrane disruption | MTT assay | H157 | Lung cancer | IC50 : 3.37 to 5.87 µM |
| dbacp02108 | cMastoparan-C(cMP-C) | CLNLKALLAVAKKILC | Synthetic construct | Apoptosis | MTT assay | H157 | Non-small cell Lung cancer | IC50 : 7.02 μM |
| dbacp02652 | Dermaseptin PS4 | MDILKKSIFLVLFLGLVSLSICEEEKRENEDEEKQEDDEQSEEKRALWKTLLKHVGKAAGKAALNAVTDMVNQGEQ | Sauvage's leaf frog | Membrane disruption | Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay | H157 | Glioma | MIC : 10−9 to 10−4 M |
| dbacp02666 | Dermaseptin-PD-1 | GMWSKIKETAMAAAKEAAKAAGKTISDMIKQ | Skin Secretion, Mexican leaf frog, Mexico, North America | Destroy plasma membrane | MTT assay | H157 | Human non-small cell Lung cancer | IC50 : 10-4 and 10-9 M |
| dbacp02669 | Dermaseptin-PD-2 | GMWSKIKNAGKAAAKAAAKAAGKAALDAVSEAI | Skin Secretion, Mexican leaf frog, Mexico, North America | Destroy plasma membrane | MTT assay | H157 | Human non-small cell lung cancer | IC50 : 6.43 μM |
| dbacp02672 | Dermaseptin-PD1 | GMWSKIKETAMAAAKEAAKAAGKTISDMIKQ | Mexican leaf frog | Destroy plasma membrane | MTT assay | H157 | Neuronal glioblastoma | IC50 : 6.43 μM |
| dbacp02675 | Dermaseptin-PD2 | GMWSKIKNAGKAAAKAAAKAAGKAALDAVSEAI | Mexican leaf frog | Destroy plasma membrane | MTT assay | H157 | Neuronal glioblastoma | IC50 : 6.43 μM |
| dbacp02679 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLVQ | Northern orange-legged leaf frog | Cell membrane permeabilization | Bioactivity assessment assay, MTT cell proliferation assay | H157 | Not specified | IC50 : 2.01 μM |
| dbacp02684 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLV | Orange-legged leaf frog, Northern orange-legged leaf frog, South America | Cell membrane permeabilization | MTT cell proliferation assay | H157 | Glioma | IC50 : 2.01 μM |
| dbacp02691 | Dermaseptin-PH | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay, Lactate dehydrogenase (LDH) assay | NCl-H157 | Lung cancer | IC50 : 17.44 - 49.51 μM |
| dbacp02703 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | H157 | Brain tumor | IC50 : 25.51 μM |
| dbacp02704 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | H157 | Breast cancer | IC50 : 25.51 μM |
| dbacp02705 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | H157 | Pancreatic cancer | IC50 : 25.51 μM |
| dbacp02706 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | H157 | Lung cancer | IC50 : 25.51 μM |
| dbacp02707 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | H157 | Prostate cancer | IC50 : 25.51 μM |
| dbacp02725 | Dermaseptin-PS3 | ALWKDILKNAGKAALNEINQIVQ | Skin, the waxy monkey tree frog, South America | Membrane rupture | MTT assay | H157 | Lung cancer | IC50 : 15.67 μM |
| dbacp02728 | Dermaseptin-PS4 | ALWKTLLKHVGKAAGKAALNAVTDMVNQ | Waxy monkey tree frog | Membrane disruption | Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay | H157 | Glioma | MIC : 10−9 to 10−4 M |
| dbacp02734 | Dermaseptin-PT9 | GLWSKIKDAAKTAGKAALGFVNEMV | Brownbelly leaf frog | Disruption of cell membranes | MTT assay, Lactate dehydrogenase (LDH) assay | NCl-H157 | Lung cancer | IC50 : 8.64 - 18.51 μM |
| dbacp02739 | Dermaseptin-PT9 | GLWSKIKDAAKTAGKAALGFVNEMV | Skin secretion, Brownbelly leaf frog, Purchased in Peru, South America | Disruption of cell membranes | MTT assay, Lactate dehydrogenase (LDH) assay | NCl-H157 | Lung cancer | IC50 : 8.64 - 18.51 μM |
| dbacp02779 | Distinctin-Like-Peptide-PH | NLVSALIEGRKYLKNVLKKLNRLKEKNKAKNSKENN | Skin Secretion, Northern orange-legged leaf frog, South America | Membrane lysis via pore formation | MTT Cell viability assay, LDH assay | H157 | Prostate carcinoma | MIC : ≥ 4.197 μM |
| dbacp03290 | HECI | TVLRGCWTFSFPPKPCI | Hylarana erythraea | Cell membrane disintegration | MTT anti-proliferation assay | H157 | Lung cancer | MIC : 1µM |
| dbacp03495 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | H157 | Brain tumor | IC50 : 9.88μM |
| dbacp03496 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | H157 | Breast cancer | IC50 : 9.88μM |
| dbacp03497 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | H157 | Pancreatic cancer | IC50 : 9.88μM |
| dbacp03498 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | H157 | Lung cancer | IC50 : 9.88μM |
| dbacp03499 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | H157 | Prostate cancer | IC50 : 9.88μM |
| dbacp03517 | Kassiniatuerin-3 | FIQHLIPLIPHAIQGIKDIF | Senegal running frog, Africa | Membranolytic mechanism | MTT assay | NCI-H157 | Non-small cell Lung cancer | IC50 : 21.54 µM |
| dbacp04573 | Mastoparan-C | LNLKALLAVAKKIL | European hornet | Apoptosis | MTT assay | H157 | Non-small cell Lung cancer | IC50 : 13.57 μM |
| dbacp04578 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | H157 | Lung cancer | MIC : 6.26 - 36.65 μM |
| dbacp04584 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | H157 | Lung cancer | IC50 : < 4 μM |
| dbacp05531 | Phylloseptin-PBa1 | FLSLIPHIASGIASLVKNF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | H157 | Lung cancer | IC50 : approx. 0.29 µM |
| dbacp05542 | Phylloseptin-PBa2 | FLSLLPHIASGIASLVSKF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | H157 | Lung cancer | IC50 : approx. 0.50 µM |
| dbacp05547 | Phylloseptin-PHa | FLSLIPAAISAVSALANHF | Skin secretions, Orange-legged Leaf Frog, South America | Membrane disruption | MTT cell viability assay | NCI-H157 | Lung cancer | IC50 : 14.10 μM |
| dbacp05549 | Phylloseptin-PHa | FLSLIPAAISAVSALANHF | Northern orange-legged leaf frog | Disruption of the membrane | MTT assay, Lactate dehydrogenase (LDH) assay | NCI-H157 | Non-small-cell Lung cancer | LD50 : < 5 µM |
| dbacp05554 | Phylloseptin-PTa | FLSLIPKIAGGIAALAKHL | Skin secretions, the Brown-bellied Leaf Frog, South America | Membrane disruption | MTT Cell viability assay | NCI-H157 | Lung cancer | IC50 : 6.73 μM |
| dbacp05793 | R2PLx-22 | GIMDTVKNAAKNLAGQLLDKLK | Not found | Inducing apoptosis | MTT and LDH assay | H157 | Lung cancer | IC50 : 843.40 µM |
| dbacp05794 | R2PLx-22 | GIMDTVKNAAKNLAGQLLDKLK | Not found | Inducing apoptosis | MTT and LDH assay | H157 | Prostate cancer | IC50 : 843.40 µM |
| dbacp05795 | R2PLx-22 | GIMDTVKNAAKNLAGQLLDKLK | Not found | Inducing apoptosis | MTT and LDH assay | H157 | Breast cancer | IC50 : 843.40 µM |
| dbacp05796 | R2PLx-22 | GIMDTVKNAAKNLAGQLLDKLK | Not found | Inducing apoptosis | MTT and LDH assay | H157 | Lung cancer | IC50 : 843.40 µM |
| dbacp05797 | R2PLx-22 | GIMDTVKNAAKNLAGQLLDKLK | Not found | Inducing apoptosis | MTT and LDH assay | H157 | Prostate cancer | IC50 : 843.40 µM |
| dbacp05798 | R2PLx-22 | GIMDTVKNAAKNLAGQLLDKLK | Not found | Inducing apoptosis | MTT and LDH assay | H157 | Breast cancer | IC50 : 843.40 µM |
| dbacp05799 | R2PLx-22 | GIMDTVKNAAKNLAGQLLDKLK | Not found | Inducing apoptosis | MTT and LDH assay | H157 | Glioma | IC50 : 843.40 µM |
| dbacp05877 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Not found | Inducing apoptosis | MTT and LDH assay | H157 | Lung cancer | IC50 : 5.90 µM |
| dbacp05878 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Not found | Inducing apoptosis | MTT and LDH assay | H157 | Prostate cancer | IC50 : 5.90 µM |
| dbacp05879 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Not found | Inducing apoptosis | MTT and LDH assay | H157 | Breast cancer | IC50 : 5.90 µM |
| dbacp05880 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Not found | Inducing apoptosis | MTT and LDH assay | H157 | Glioma | IC50 : 5.90 µM |
| dbacp05901 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Gram-negative purple non-sulfur bacteria | Inducing apoptosis | MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay | H157 | Lung | IC50 : 5.90 µM |
| dbacp05906 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Skin secretions, the pickerel frog, North America | Inducing apoptosis | MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay | H157 | Lung cancer | IC50 : 5.90 µM |
| dbacp05984 | S−24-R2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Not found | Inducing apoptosis | MTT and LDH assay | H157 | Lung cancer | IC50 : 58.18 µM |
| dbacp05985 | S−24-R2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Not found | Inducing apoptosis | MTT and LDH assay | H157 | Prostate cancer | IC50 : 58.18 µM |
| dbacp05986 | S−24-R2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Not found | Inducing apoptosis | MTT and LDH assay | H157 | Breast cancer | IC50 : 58.18 µM |
| dbacp05987 | S−24-R2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Not found | Inducing apoptosis | MTT and LDH assay | H157 | Glioma | IC50 : 58.18 µM |
| dbacp06183 | t Mastoparan-C(tMP-C, Tat (49-57)-Mastoparan-C) | RKKRRQRRRLNLKALLAVAKKIL | Synthetic construct | Apoptosis inducing | MTT assay | H157 | Non-small cell Lung cancer | IC50 : 2.79 μM |
| dbacp06267 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | NCI-H157 | Lung cancer | TI : 10μM |
| dbacp06271 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | NCI-H157 | Human neuronal glioblastoma | TI : 10μM |
| dbacp06275 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | NCI-H157 | Human neuronal glioblastoma | TI : 10μM |
| dbacp06279 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | NCI-H157 | Melanoma | TI : 10μM |
| dbacp06283 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | NCI-H157 | Lung cancer | TI : approx. 10μM |
| dbacp06366 | TsAP-2 | FLGMIPGLIGGLISAFK | Venom, the Brazilian yellow scorpion, South America | Not specified | MTT/MTS assay | NCI-H157 | Human squamous carcinoma | IC50 : 4.1 µM |
| dbacp06374 | TsAP-S1 | FLSLIPKLVKKIIKAFK | The iNot foundctive natural peptide TsAP-1 was made active by increasing 4 lysines and one leucine, template-based design | Not specified | MTT/MTS assay | NCI-H157 | Human squamous carcinoma | IC50 : 55.9 µM |