dbACP: A Comprehensive Database of Anti-Cancer Peptides

4 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp06301 Tf-D-LP4 HAIYPRHSWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified CLL Leukemia IC50 : 1.2 ± 0.1 µM
dbacp06302 Tf-D-LP4 HAIYPRHSWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified MEC-1 Leukemia IC50 : 1.8 ± 0.2 µM
dbacp06303 Tf-LP4 HAIYPRHSWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified CLL Leukemia IC50 : 1.7 ± 0.2 µM
dbacp06304 Tf-LP4 HAIYPRHSWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified MEC-1 Leukemia IC50 : 3.6 ± 0.2 µM