10 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp02785 | dLL-37(17-32)c | FKRIVQRIKDFLRNLV | LL-37, a series of peptide fragments | Cell membrane disintegration | MTT/MTS assay | HBMEC | Prostate cancer | Not found |
| dbacp04157 | LL-37(1-12) | LLGDFFRKSKEK | LL-37,a series of peptide fragments | Cell membrane disintegration | MTT/MTS assay | HBMEC | Prostate cancer | Not found |
| dbacp04160 | LL-37(1-4,17-27) | LLGDFKRIVQRIKDF | LL-37,a series of peptide fragments | Cell membrane disintegration | MTT/MTS assay | HBMEC | Prostate cancer | Not found |
| dbacp04163 | LL-37(13-37) | IGKEFKRIVQRIKDFLRNLVPRTES | LL-37,a series of peptide fragments | Cell membrane disintegration | MTT/MTS assay | HBMEC | Prostate cancer | LC50 : 38 µM |
| dbacp04166 | LL-37(13-37)(C-terminal fragment of LL-37; Human, mammals, animals) | IGKEFKRIVQRIKDFLRNLVPRTES | Human | Not specified | MTT assay | HBMEC | Prostate cancer | LC50 : 38 ± 3 μM |
| dbacp04169 | LL-37(17-29) | FKRIVQRIKDFLR | LL-37,a series of peptide fragments | Cell membrane disintegration | MTT/MTS assay | HBMEC | Prostate cancer | LC50 : 55 µM |
| dbacp04173 | LL-37(17-29)(C-terminal fragment of LL-37; Human, mammals, animals) | FKRIVQRIKDFLRNLV | Human | Not specified | MTT assay | HBMEC | Prostate cancer | LC50 : 55 ± 2 μM |
| dbacp04176 | LL-37(17-32)(C-terminal fragment of LL-37; Human, mammals, animals) | FKRIVQRIKDFLRNLV | Human | Not specified | MTT assay | HBMEC | Prostate cancer | LC50 : 25 ± 1 μM |
| dbacp04179 | LL-37(17-32)b | FKRIVQRIKDFLRNLV | LL-37,a series of peptide fragments | Cell membrane disintegration | MTT/MTS assay | HBMEC | Prostate cancer | LC50 : 25 µM |
| dbacp08076 | PvD1 | KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC | Phaseolus vulgaris | Disrupts tumor cells | MTT assay | HBMEC | Brain Cancer | Not Available |