dbACP: A Comprehensive Database of Anti-Cancer Peptides

10 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02785 dLL-37(17-32)c FKRIVQRIKDFLRNLV LL-37, a series of peptide fragments Cell membrane disintegration MTT/MTS assay HBMEC Prostate cancer Not found
dbacp04157 LL-37(1-12) LLGDFFRKSKEK LL-37,a series of peptide fragments Cell membrane disintegration MTT/MTS assay HBMEC Prostate cancer Not found
dbacp04160 LL-37(1-4,17-27) LLGDFKRIVQRIKDF LL-37,a series of peptide fragments Cell membrane disintegration MTT/MTS assay HBMEC Prostate cancer Not found
dbacp04163 LL-37(13-37) IGKEFKRIVQRIKDFLRNLVPRTES LL-37,a series of peptide fragments Cell membrane disintegration MTT/MTS assay HBMEC Prostate cancer LC50 : 38 µM
dbacp04166 LL-37(13-37)(C-terminal fragment of LL-37; Human, mammals, animals) IGKEFKRIVQRIKDFLRNLVPRTES Human Not specified MTT assay HBMEC Prostate cancer LC50 : 38 ± 3 μM
dbacp04169 LL-37(17-29) FKRIVQRIKDFLR LL-37,a series of peptide fragments Cell membrane disintegration MTT/MTS assay HBMEC Prostate cancer LC50 : 55 µM
dbacp04173 LL-37(17-29)(C-terminal fragment of LL-37; Human, mammals, animals) FKRIVQRIKDFLRNLV Human Not specified MTT assay HBMEC Prostate cancer LC50 : 55 ± 2 μM
dbacp04176 LL-37(17-32)(C-terminal fragment of LL-37; Human, mammals, animals) FKRIVQRIKDFLRNLV Human Not specified MTT assay HBMEC Prostate cancer LC50 : 25 ± 1 μM
dbacp04179 LL-37(17-32)b FKRIVQRIKDFLRNLV LL-37,a series of peptide fragments Cell membrane disintegration MTT/MTS assay HBMEC Prostate cancer LC50 : 25 µM
dbacp08076 PvD1 KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC Phaseolus vulgaris Disrupts tumor cells MTT assay HBMEC Brain Cancer Not Available