dbACP: A Comprehensive Database of Anti-Cancer Peptides

6 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp01294 Aurein-1.3 GLFDIIKKIAESF Southern bell frog Cell membrane disintegration One-dose and five-dose assay HCT-15 Colon cancer IC50 : 4-5 μM
dbacp02041 Buforin IIb RAGLQFPVGRLLRRLLRRLLR Histone H2A Inducing mitochondria-dependent apoptosis MTT/MTS assay HCT-15 Colon cancer IC50 : 13.2 µg/ml
dbacp02100 Buforin Iib RAGLQFPVGRLLRRLLRRLLR Not found Inducing apoptosis MTT/MTS assay HCT-15 Not specified IC50 : 12 µg/ml
dbacp02103 Buforin Iib RAGLQFPVGRLLRRLLRRLLR Not found Inducing apoptosis MTT/MTS assay HCT-15 Not specified IC50 : 17.6 µg/ml
dbacp04656 Melittin GIGAVLKVLTTGLPALISWIKRKRQQ Honey bee Membrane damage as swelling; Breakage or blebbing Live/Dead staining and florescence microscopy assay HCT-15 Human adenocarcinoma MIC : 5 μg/mL
dbacp07547 Sur-X YGRKKRRQRRRKDHRISTFKNWPFLEGCACTPERM Synthetic Disrupts XIAP-survivin, induces apoptosis/necroptosis MTT assay HCT-15 Colon Cancer Not Available