6 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp01294 | Aurein-1.3 | GLFDIIKKIAESF | Southern bell frog | Cell membrane disintegration | One-dose and five-dose assay | HCT-15 | Colon cancer | IC50 : 4-5 μM |
| dbacp02041 | Buforin IIb | RAGLQFPVGRLLRRLLRRLLR | Histone H2A | Inducing mitochondria-dependent apoptosis | MTT/MTS assay | HCT-15 | Colon cancer | IC50 : 13.2 µg/ml |
| dbacp02100 | Buforin Iib | RAGLQFPVGRLLRRLLRRLLR | Not found | Inducing apoptosis | MTT/MTS assay | HCT-15 | Not specified | IC50 : 12 µg/ml |
| dbacp02103 | Buforin Iib | RAGLQFPVGRLLRRLLRRLLR | Not found | Inducing apoptosis | MTT/MTS assay | HCT-15 | Not specified | IC50 : 17.6 µg/ml |
| dbacp04656 | Melittin | GIGAVLKVLTTGLPALISWIKRKRQQ | Honey bee | Membrane damage as swelling; Breakage or blebbing | Live/Dead staining and florescence microscopy assay | HCT-15 | Human adenocarcinoma | MIC : 5 μg/mL |
| dbacp07547 | Sur-X | YGRKKRRQRRRKDHRISTFKNWPFLEGCACTPERM | Synthetic | Disrupts XIAP-survivin, induces apoptosis/necroptosis | MTT assay | HCT-15 | Colon Cancer | Not Available |