2 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp05222 | Penaeidin-2 | YRGGYTGPIPRPPPIGRPPLPRVVCACYRLSVSDARNCCIKFGSCCHLVK | Pacific white shrimp | Induction of apoptosis | MTT assay | HK-2 | Kidney cancer | MIC : 100 μg/mL |
| dbacp05402 | Peptide from Lentinus Squarrosulus | RYGFTEVAGNFQQHNFGRG | Plant sources | Inducing apoptosis | MTT assay | HK-2 | Breast cancer | Not found |