dbACP: A Comprehensive Database of Anti-Cancer Peptides

4 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp08020 Peptide4 Gonearrestide ADAPGNYPLDARGKSYYC Androctonus australis Gonearrestide induces G1 cell-cycle arrest MTT assay HKe-3 Colon Cancer Not Available
dbacp08025 Peptide6 Gonearrestide KLSAIISKIRDE Androctonus australis Gonearrestide induces G1 cell-cycle arrest MTT assay HKe-3 Colon Cancer Not Available
dbacp08030 Peptide10 Gonearrestide NDADKDEMQSVYRGKANDDNSRGSKTNHRF Androctonus mauritanicus Gonearrestide induces G1 cell-cycle arrest MTT assay HKe-3 Colon Cancer Not Available
dbacp08035 Peptide13 Gonearrestide WCYKLPDRVSIKEKGRCN Androctonus mauritanicus Gonearrestide induces G1 cell-cycle arrest MTT assay HKe-3 Colon Cancer Not Available