26 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp01435 | B1AW | FLPLLAGLAANFLPQIICKIARKC | Wuyi torrent frog | Cell membrane penetration | MTT assay | HMEC-1 | Glioblastoma cancer | IC50 : 32.96 μM |
| dbacp02718 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Brain tumor | IC50 : 51.04 μM |
| dbacp02719 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Breast cancer | IC50 : 51.04 μM |
| dbacp02720 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Pancreatic cancer | IC50 : 51.04 μM |
| dbacp02721 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Lung cancer | IC50 : 51.04 μM |
| dbacp02722 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Prostate cancer | IC50 : 51.04 μM |
| dbacp03510 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Brain tumor | IC50 : 48.80μM |
| dbacp03511 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Breast cancer | IC50 : 48.80μM |
| dbacp03512 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Pancreatic cancer | IC50 : 48.80μM |
| dbacp03513 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Lung cancer | IC50 : 48.80μM |
| dbacp03514 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Prostate cancer | IC50 : 48.80μM |
| dbacp04583 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | HMEC-1 | Glioma | MIC : 6.26 - 36.65 μM |
| dbacp04589 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | HMEC-1 | Glioma | IC50 : < 4 μM |
| dbacp05816 | R2PLx-22 | GIMDTVKNAAKNLAGQLLDKLK | Not found | Inducing apoptosis | MTT and LDH assay | HMEC-1 | Lung cancer | IC50 : 588.20 µM |
| dbacp05817 | R2PLx-22 | GIMDTVKNAAKNLAGQLLDKLK | Not found | Inducing apoptosis | MTT and LDH assay | HMEC-1 | Prostate cancer | IC50 : 588.20 µM |
| dbacp05818 | R2PLx-22 | GIMDTVKNAAKNLAGQLLDKLK | Not found | Inducing apoptosis | MTT and LDH assay | HMEC-1 | Breast cancer | IC50 : 588.20 µM |
| dbacp05819 | R2PLx-22 | GIMDTVKNAAKNLAGQLLDKLK | Not found | Inducing apoptosis | MTT and LDH assay | HMEC-1 | Glioma | IC50 : 588.20 µM |
| dbacp05897 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Not found | Inducing apoptosis | MTT and LDH assay | HMEC-1 | Lung cancer | IC50 : 79.50 µM |
| dbacp05898 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Not found | Inducing apoptosis | MTT and LDH assay | HMEC-1 | Prostate cancer | IC50 : 79.50 µM |
| dbacp05899 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Not found | Inducing apoptosis | MTT and LDH assay | HMEC-1 | Breast cancer | IC50 : 79.50 µM |
| dbacp05900 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Not found | Inducing apoptosis | MTT and LDH assay | HMEC-1 | Glioma | IC50 : 79.50 µM |
| dbacp05911 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Skin secretions, the pickerel frog, North America | Inducing apoptosis | MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay | HMEC-1 | Glioma | IC50 : 79.50 µM |
| dbacp06004 | S−24-R2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Not found | Inducing apoptosis | MTT and LDH assay | HMEC-1 | Lung cancer | IC50 : 1185.00 µM |
| dbacp06005 | S−24-R2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Not found | Inducing apoptosis | MTT and LDH assay | HMEC-1 | Prostate cancer | IC50 : 1185.00 µM |
| dbacp06006 | S−24-R2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Not found | Inducing apoptosis | MTT and LDH assay | HMEC-1 | Breast cancer | IC50 : 1185.00 µM |
| dbacp06007 | S−24-R2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Not found | Inducing apoptosis | MTT and LDH assay | HMEC-1 | Glioma | IC50 : 1185.00 µM |