dbACP: A Comprehensive Database of Anti-Cancer Peptides

9 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02431 ChaC1 (Chassatide C1; Plant defensin) GDACGETCFTGICFTAGCSCNPWPTCTRN Beras-beras Not specified MTT assay HeLa cells Not found IC50 : 9.8 µM
dbacp02433 ChaC10 (Chassatide C10; Plant defensin) GEYCGESCYLIPCFTPGCYCVSRQCVNKN Beras-beras Not specified MTT assay HeLa cells Not found IC50 : 5.0 µM
dbacp02437 ChaC2 (Chassatide C2; Plant defensin) GIPCAESCVWIPPCTITALMGCSCKNNVCYNN Beras-beras Not specified MTT assay HeLa cells Not found IC50 : 2.4 µM
dbacp02439 ChaC4 (Chassatide C4; Plant defensin) GASCGETCFTGICFTAGCSCNPWPTCTRN Beras-beras Not specified MTT assay HeLa cells Not found IC50 : 9.8 µM
dbacp02517 Cliotide T1 (cT1; Plant defensin) GIPCGESCVFIPCITAAIGCSCKSKVCYRN Butterfly pea Not specified MTT assay HeLa cells Not found IC50 : 0.6 µM
dbacp02523 Cliotide T2 (cT2; Plant defensin) GEFLKCGESCVQGECYTPGCSCDWPICKKN Butterfly pea Not specified MTT assay HeLa cells Not found IC50 : 8.0 µM
dbacp02526 Cliotide T3 (cT3; Plant defensin) GLPTCGETCTLGTCYVPDCSCSWPICMKN Butterfly pea Not specified MTT assay HeLa cells Not found IC50 : 2.0 µM
dbacp02529 Cliotide T4 (cT4; Plant defensin) GIPCGESCVFIPCITGAIGCSCKSKVCYRN Butterfly pea Not specified MTT assay HeLa cells Not found IC50 : 0.6 µM
dbacp06500 Vigno 5 GLPLCGETCVGGTCNTPGCSCGWPVCVRN Viola ignobilis Apoptosis inducing MTT assay, AO/EB and DAPI staining assay HeLa cells Cervical cancer IC50 : 2.5 – 10 μM