dbACP: A Comprehensive Database of Anti-Cancer Peptides

1 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp04595 Mauriporin MNKKTLLVIFFITMLIVDEVNSFKIGGFIKKLWRSKLAKKLRAKGRELLKDYANRVINGGPEEEAAVPAERRR Fat-tailed scorpion Induce cell apoptosis; Targets on the cell membranes and caused membrane lysis MTT assay, Lactate dehydrogenase (LDH) Release assay PC-3 Human Prostate cancer IC50 : 27.9 μM - 283.3 μM