dbACP: A Comprehensive Database of Anti-Cancer Peptides

3 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp00822 AaeAP1 FLFSLIPSVIAGLVSAIRN Venom, Aeneas fattailed scorpion, Africa Membrane lysis MTT assay MB435s Human breast carcinoma MIC : 10−4 to 10−9 M
dbacp00830 AaeAP2 FLFSLIPSAIAGLVSAIRN Venom, Aeneas fattailed scorpion, Africa Membrane lysis MTT assay MB435s Human breast carcinoma MIC : 10−4 to 10−9 M
dbacp01163 Antimicrobial peptide TsAP-1 MQIKHLITLFFLVLIVADQCSAFLSLIPSLVGGSISAFKGRRKREISAQIEQYKDLQKREAELEELLDRLPMY Brazilian scorpion Membrane disruption MTT Cell viability assay MCF-7 Human breast carcinoma IC50 : 0.83 - 2.0 μM