dbACP: A Comprehensive Database of Anti-Cancer Peptides

3 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp01167 Antimicrobial peptide TsAP-2 MQIKHLITIFFLVLIVADHCHAFLGMIPGLIGGLISAFKGRRKREITSQIEQYRNLQKREAELENLLANLPVY Brazilian scorpion Not specified Cell proliferation assay HepG2 Human hepatocellular carcinoma MIC : 40 µM
dbacp03359 Hymenochirin-1B IKLSPETKDNLKKVLKGAIKGAIAVAKMV-NH5 Zaire dwarf clawed frog Induce apoptosis and cell cycle arrest LDH release assay, MTT assay HepG2 Human hepatocellular carcinoma MIC : 0 - 50 μM
dbacp03360 Hymenochirin-1B IKLSPETKDNLKKVLKGAIKGAIAVAKMV-NH6 Zaire dwarf clawed frog Induce apoptosis and cell cycle arrest LDH release assay, MTT assay PLC Human hepatocellular carcinoma MIC : 0 - 50 μM