3 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp01167 | Antimicrobial peptide TsAP-2 | MQIKHLITIFFLVLIVADHCHAFLGMIPGLIGGLISAFKGRRKREITSQIEQYRNLQKREAELENLLANLPVY | Brazilian scorpion | Not specified | Cell proliferation assay | HepG2 | Human hepatocellular carcinoma | MIC : 40 µM |
| dbacp03359 | Hymenochirin-1B | IKLSPETKDNLKKVLKGAIKGAIAVAKMV-NH5 | Zaire dwarf clawed frog | Induce apoptosis and cell cycle arrest | LDH release assay, MTT assay | HepG2 | Human hepatocellular carcinoma | MIC : 0 - 50 μM |
| dbacp03360 | Hymenochirin-1B | IKLSPETKDNLKKVLKGAIKGAIAVAKMV-NH6 | Zaire dwarf clawed frog | Induce apoptosis and cell cycle arrest | LDH release assay, MTT assay | PLC | Human hepatocellular carcinoma | MIC : 0 - 50 μM |