5 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp00821 | AaeAP1 | FLFSLIPSVIAGLVSAIRN | Venom, Aeneas fattailed scorpion, Africa | Membrane lysis | MTT assay | NCI-H460 | Human lung adenocarcinoma | MIC : 10−4 to 10−9 M |
| dbacp00829 | AaeAP2 | FLFSLIPSAIAGLVSAIRN | Venom, Aeneas fattailed scorpion, Africa | Membrane lysis | MTT assay | NCI-H460 | Human lung adenocarcinoma | MIC : 10−4 to 10−9 M |
| dbacp01161 | Antimicrobial peptide TsAP-1 | MQIKHLITLFFLVLIVADQCSAFLSLIPSLVGGSISAFKGRRKREISAQIEQYKDLQKREAELEELLDRLPMY | Brazilian scorpion | Membrane disruption | MTT Cell viability assay | NCIeH838 | Human Lung adenocarcinoma | IC50 : 0.83 - 2.0 μM |
| dbacp02814 | Drosophila Antennapedia homodomain PFV | CALNNPFVYLI | Fruit fly homodomain PFV | Cell membrane disintegration | SPR assay | A549 | Human lung adenocarcinoma | Not found |
| dbacp05821 | R8 | CALRRRRRRRR | Not found | Cell membrane disintegration | SPR assay | A549 | Human lung adenocarcinoma | Not found |