dbACP: A Comprehensive Database of Anti-Cancer Peptides

5 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp00821 AaeAP1 FLFSLIPSVIAGLVSAIRN Venom, Aeneas fattailed scorpion, Africa Membrane lysis MTT assay NCI-H460 Human lung adenocarcinoma MIC : 10−4 to 10−9 M
dbacp00829 AaeAP2 FLFSLIPSAIAGLVSAIRN Venom, Aeneas fattailed scorpion, Africa Membrane lysis MTT assay NCI-H460 Human lung adenocarcinoma MIC : 10−4 to 10−9 M
dbacp01161 Antimicrobial peptide TsAP-1 MQIKHLITLFFLVLIVADQCSAFLSLIPSLVGGSISAFKGRRKREISAQIEQYKDLQKREAELEELLDRLPMY Brazilian scorpion Membrane disruption MTT Cell viability assay NCIeH838 Human Lung adenocarcinoma IC50 : 0.83 - 2.0 μM
dbacp02814 Drosophila Antennapedia homodomain PFV CALNNPFVYLI Fruit fly homodomain PFV Cell membrane disintegration SPR assay A549 Human lung adenocarcinoma Not found
dbacp05821 R8 CALRRRRRRRR Not found Cell membrane disintegration SPR assay A549 Human lung adenocarcinoma Not found