7 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp01160 | Antimicrobial peptide TsAP-1 | MQIKHLITLFFLVLIVADQCSAFLSLIPSLVGGSISAFKGRRKREISAQIEQYKDLQKREAELEELLDRLPMY | Brazilian scorpion | Membrane disruption | MTT Cell viability assay | NCIeH157 | Human squamous carcinoma | IC50 : 0.83 - 2.0 μM |
| dbacp06365 | TsAP-2 | FLGMIPGLIGGLISAFK | Venom, the Brazilian yellow scorpion, South America | Not specified | MTT/MTS assay | U251-MG | Human squamous carcinoma | IC50 : 15.4 µM |
| dbacp06366 | TsAP-2 | FLGMIPGLIGGLISAFK | Venom, the Brazilian yellow scorpion, South America | Not specified | MTT/MTS assay | NCI-H157 | Human squamous carcinoma | IC50 : 4.1 µM |
| dbacp06367 | TsAP-2 | FLGMIPGLIGGLISAFK | Venom, the Brazilian yellow scorpion, South America | Not specified | MTT/MTS assay | NCI-H838 | Human squamous carcinoma | IC50 : 11.0 µM |
| dbacp06373 | TsAP-S1 | FLSLIPKLVKKIIKAFK | The iNot foundctive natural peptide TsAP-1 was made active by increasing 4 lysines and one leucine, template-based design | Not specified | MTT/MTS assay | U251-MG | Human squamous carcinoma | IC50 : 0.83 - 2.0 µM |
| dbacp06374 | TsAP-S1 | FLSLIPKLVKKIIKAFK | The iNot foundctive natural peptide TsAP-1 was made active by increasing 4 lysines and one leucine, template-based design | Not specified | MTT/MTS assay | NCI-H157 | Human squamous carcinoma | IC50 : 55.9 µM |
| dbacp06375 | TsAP-S1 | FLSLIPKLVKKIIKAFK | The iNot foundctive natural peptide TsAP-1 was made active by increasing 4 lysines and one leucine, template-based design | Not specified | MTT/MTS assay | NCI-H838 | Human squamous carcinoma | IC50 : 52.5µM |