dbACP: A Comprehensive Database of Anti-Cancer Peptides

7 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp01160 Antimicrobial peptide TsAP-1 MQIKHLITLFFLVLIVADQCSAFLSLIPSLVGGSISAFKGRRKREISAQIEQYKDLQKREAELEELLDRLPMY Brazilian scorpion Membrane disruption MTT Cell viability assay NCIeH157 Human squamous carcinoma IC50 : 0.83 - 2.0 μM
dbacp06365 TsAP-2 FLGMIPGLIGGLISAFK Venom, the Brazilian yellow scorpion, South America Not specified MTT/MTS assay U251-MG Human squamous carcinoma IC50 : 15.4 µM
dbacp06366 TsAP-2 FLGMIPGLIGGLISAFK Venom, the Brazilian yellow scorpion, South America Not specified MTT/MTS assay NCI-H157 Human squamous carcinoma IC50 : 4.1 µM
dbacp06367 TsAP-2 FLGMIPGLIGGLISAFK Venom, the Brazilian yellow scorpion, South America Not specified MTT/MTS assay NCI-H838 Human squamous carcinoma IC50 : 11.0 µM
dbacp06373 TsAP-S1 FLSLIPKLVKKIIKAFK The iNot foundctive natural peptide TsAP-1 was made active by increasing 4 lysines and one leucine, template-based design Not specified MTT/MTS assay U251-MG Human squamous carcinoma IC50 : 0.83 - 2.0 µM
dbacp06374 TsAP-S1 FLSLIPKLVKKIIKAFK The iNot foundctive natural peptide TsAP-1 was made active by increasing 4 lysines and one leucine, template-based design Not specified MTT/MTS assay NCI-H157 Human squamous carcinoma IC50 : 55.9 µM
dbacp06375 TsAP-S1 FLSLIPKLVKKIIKAFK The iNot foundctive natural peptide TsAP-1 was made active by increasing 4 lysines and one leucine, template-based design Not specified MTT/MTS assay NCI-H838 Human squamous carcinoma IC50 : 52.5µM