dbACP: A Comprehensive Database of Anti-Cancer Peptides

9 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp01305 Aurein-2.2 [Cleaved into: Aurein-2.2.1] MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGALGSLGKRNDLE Green and golden bell frog Membrane disruption Not specified Human tumour cell lines Colorectal cancer LC50 : 10-5 - 10-4 M
dbacp01306 Aurein-2.3 MAFLKKSLFLVLFLGLVSLSICEKEKRQNGEDEDENEAANHEEGSEEKRGLFDIVKKVVGAIGSLGKRNDVE Green and golden bell frog Membrane disruption Not specified Human tumour cell lines Prostate cancer LC50 : 10-5 - 10-4 M
dbacp01338 Aurein-2.5 MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE Green and golden bell frog Membrane disruption Not specified Human tumour cell lines Leukaemia LC50 : 10-5 - 10-4 M
dbacp01339 Aurein-2.5 MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE Green and golden bell frog Membrane disruption Not specified Human tumour cell lines Lung cancer LC50 : 10-5 - 10-4 M
dbacp01340 Aurein-2.5 MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE Green and golden bell frog Membrane disruption Not specified Human tumour cell lines Colon cancer LC50 : 10-5 - 10-4 M
dbacp01341 Aurein-2.5 MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE Green and golden bell frog Membrane disruption Not specified Human tumour cell lines Prostate cancer LC50 : 10-5 - 10-4 M
dbacp01342 Aurein-2.5 MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE Green and golden bell frog Membrane disruption Not specified Human tumour cell lines Breast cancer LC50 : 10-5 - 10-4 M
dbacp01343 Aurein-2.5 GLFDIVKKVVGAFGSL Green and golden bell frog Membrane disruption Not specified Human tumour cell lines Leukaemia LC50 : 10-5 - 10-4 M
dbacp01367 Aurein-3.1 [Cleaved into: Aurein-3.1.1; Aurein-3.1.2] MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKIAGHIAGSIGKKR Green and golden bell frog Membrane disruption Not specified Human tumour cell lines Lung cancer LC50 : 10-5 - 10-4 M