9 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp01305 | Aurein-2.2 [Cleaved into: Aurein-2.2.1] | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGALGSLGKRNDLE | Green and golden bell frog | Membrane disruption | Not specified | Human tumour cell lines | Colorectal cancer | LC50 : 10-5 - 10-4 M |
| dbacp01306 | Aurein-2.3 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNGEDEDENEAANHEEGSEEKRGLFDIVKKVVGAIGSLGKRNDVE | Green and golden bell frog | Membrane disruption | Not specified | Human tumour cell lines | Prostate cancer | LC50 : 10-5 - 10-4 M |
| dbacp01338 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Membrane disruption | Not specified | Human tumour cell lines | Leukaemia | LC50 : 10-5 - 10-4 M |
| dbacp01339 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Membrane disruption | Not specified | Human tumour cell lines | Lung cancer | LC50 : 10-5 - 10-4 M |
| dbacp01340 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Membrane disruption | Not specified | Human tumour cell lines | Colon cancer | LC50 : 10-5 - 10-4 M |
| dbacp01341 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Membrane disruption | Not specified | Human tumour cell lines | Prostate cancer | LC50 : 10-5 - 10-4 M |
| dbacp01342 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Membrane disruption | Not specified | Human tumour cell lines | Breast cancer | LC50 : 10-5 - 10-4 M |
| dbacp01343 | Aurein-2.5 | GLFDIVKKVVGAFGSL | Green and golden bell frog | Membrane disruption | Not specified | Human tumour cell lines | Leukaemia | LC50 : 10-5 - 10-4 M |
| dbacp01367 | Aurein-3.1 [Cleaved into: Aurein-3.1.1; Aurein-3.1.2] | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKIAGHIAGSIGKKR | Green and golden bell frog | Membrane disruption | Not specified | Human tumour cell lines | Lung cancer | LC50 : 10-5 - 10-4 M |