23 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp02231 | CA-MA | KWKLFKKIGIGKFLHSAKKF | Ceropin-African clawed frog hybrid peptides | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 65 µM |
| dbacp02232 | CA-MA | KWKLFKKIGIGKFLHSAKKF | Ceropin-African clawed frog hybrid peptides | Cell membrane disintegration | MTT/MTS assay | A-549 | Lung cancer | IC50 : 60 µM |
| dbacp02233 | CA-MA | KWKLFKKIGIGKFLHSAKKF | Ceropin-African clawed frog hybrid peptides | Cell membrane disintegration | MTT/MTS assay | Jurkat | Blood cancer | IC50 : 30 µM |
| dbacp02234 | CA-MA | KWKLFKKIGIGKFLHSAKKF | Ceropin-African clawed frog hybrid peptides | Cell membrane disintegration | MTT/MTS assay | MDA-MB-361 | Breast cancer | IC50 : 44 µM |
| dbacp02241 | CA-MA1 | KWKLFKKIKFLHSAKKF | Ceropin-African clawed frog hybrid peptides | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 85.3 µM |
| dbacp02242 | CA-MA1 | KWKLFKKIKFLHSAKKF | Ceropin-African clawed frog hybrid peptides | Cell membrane disintegration | MTT/MTS assay | A-549 | Lung cancer | IC50 : 100 µM |
| dbacp02243 | CA-MA1 | KWKLFKKIKFLHSAKKF | Ceropin-African clawed frog hybrid peptides | Cell membrane disintegration | MTT/MTS assay | Jurkat | Blood cancer | IC50 : 65 µM |
| dbacp02244 | CA-MA1 | KWKLFKKIKFLHSAKKF | Ceropin-African clawed frog hybrid peptides | Cell membrane disintegration | MTT/MTS assay | MDA-MB-361 | Breast cancer | IC50 : 100 µM |
| dbacp02245 | CA-MA2 | KWKLFKKIPKFLHSAKKF | Ceropin-African clawed frog hybrid peptides | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 35.1 µM |
| dbacp02246 | CA-MA2 | KWKLFKKIPKFLHSAKKF | Ceropin-African clawed frog hybrid peptides | Cell membrane disintegration | MTT/MTS assay | A-549 | Lung cancer | IC50 : 25 µM |
| dbacp02247 | CA-MA2 | KWKLFKKIPKFLHSAKKF | Ceropin-African clawed frog hybrid peptides | Cell membrane disintegration | MTT/MTS assay | Jurkat | Blood cancer | IC50 : 20 µM |
| dbacp02248 | CA-MA2 | KWKLFKKIPKFLHSAKKF | Ceropin-African clawed frog hybrid peptides | Cell membrane disintegration | MTT/MTS assay | MDA-MB-361 | Breast cancer | IC50 : 28 µM |
| dbacp02249 | CA-MA3 | KWKLFKKIGPGKFLHSAKKF | Ceropin-African clawed frog hybrid peptides | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : >100 µM |
| dbacp02250 | CA-MA3 | KWKLFKKIGPGKFLHSAKKF | Ceropin-African clawed frog hybrid peptides | Cell membrane disintegration | MTT/MTS assay | A-549 | Lung cancer | IC50 : >100 µM |
| dbacp02251 | CA-MA3 | KWKLFKKIGPGKFLHSAKKF | Ceropin-African clawed frog hybrid peptides | Cell membrane disintegration | MTT/MTS assay | Jurkat | Blood cancer | IC50 : 75 µM |
| dbacp02252 | CA-MA3 | KWKLFKKIGPGKFLHSAKKF | Ceropin-African clawed frog hybrid peptides | Cell membrane disintegration | MTT/MTS assay | MDA-MB-361 | Breast cancer | IC50 : >100 µM |
| dbacp02342 | Cecropin A | KWKLFKKIKFLHSAKKF | Hybrid peptide | Disrupting the ionic homeostasis of the bacterium; Cell lysis | Inhibition zone assay | Not found | Not found | MIC : 0.125 - 32 mg/ml |
| dbacp02430 | ChaC1 | GDACGETCFTGICFTAGCSCNPWPTCTRN | Hybrid peptide of melittin and protamine | Permeabilization of the lipid membrane of the target cells | Not specified | Not found | Not found | Not found |
| dbacp06794 | CM11 | WKLFKKILKVL | Cecropin-Melittin Hybrid Peptide | Apoptosis inducing | MTT assay | Jurkat | Blood Cancer | Survival rate = 47% at 32 μg/ml |
| dbacp06795 | CM11 | WKLFKKILKVL | Cecropin-Melittin Hybrid Peptide | Apoptosis inducing | MTT assay | Raji | Blood Cancer | Survival rate = 51% at 32 μg/ml |
| dbacp06865 | Pep-1-Phor21 | CGEMGWVRCKFAKFAKKFAKFAKKFAKFAK | Hybrid peptide PEP1 and Phor 21 | Not available | AlamarBlue assay | LNCaP | Liver Cancer | IC50 = 55.13 ± 13.56 µM |
| dbacp06866 | Pep-1-Phor21 | CGEMGWVRCKFAKFAKKFAKFAKKFAKFAK | Hybrid peptide PEP1 and Phor 21 | Not available | AlamarBlue assay | DU-145 | Prostrate Cancer | IC50 = 2.57 ± 2.02 µM |
| dbacp06867 | Pep-1-Phor21 | CGEMGWVRCKFAKFAKKFAKFAKKFAKFAK | Hybrid peptide PEP1 and Phor 21 | Not available | AlamarBlue assay | PC-3 | Prostrate Cancer | IC50 ≤ 0.6 μM |