dbACP: A Comprehensive Database of Anti-Cancer Peptides

23 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02231 CA-MA KWKLFKKIGIGKFLHSAKKF Ceropin-African clawed frog hybrid peptides Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 65 µM
dbacp02232 CA-MA KWKLFKKIGIGKFLHSAKKF Ceropin-African clawed frog hybrid peptides Cell membrane disintegration MTT/MTS assay A-549 Lung cancer IC50 : 60 µM
dbacp02233 CA-MA KWKLFKKIGIGKFLHSAKKF Ceropin-African clawed frog hybrid peptides Cell membrane disintegration MTT/MTS assay Jurkat Blood cancer IC50 : 30 µM
dbacp02234 CA-MA KWKLFKKIGIGKFLHSAKKF Ceropin-African clawed frog hybrid peptides Cell membrane disintegration MTT/MTS assay MDA-MB-361 Breast cancer IC50 : 44 µM
dbacp02241 CA-MA1 KWKLFKKIKFLHSAKKF Ceropin-African clawed frog hybrid peptides Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 85.3 µM
dbacp02242 CA-MA1 KWKLFKKIKFLHSAKKF Ceropin-African clawed frog hybrid peptides Cell membrane disintegration MTT/MTS assay A-549 Lung cancer IC50 : 100 µM
dbacp02243 CA-MA1 KWKLFKKIKFLHSAKKF Ceropin-African clawed frog hybrid peptides Cell membrane disintegration MTT/MTS assay Jurkat Blood cancer IC50 : 65 µM
dbacp02244 CA-MA1 KWKLFKKIKFLHSAKKF Ceropin-African clawed frog hybrid peptides Cell membrane disintegration MTT/MTS assay MDA-MB-361 Breast cancer IC50 : 100 µM
dbacp02245 CA-MA2 KWKLFKKIPKFLHSAKKF Ceropin-African clawed frog hybrid peptides Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 35.1 µM
dbacp02246 CA-MA2 KWKLFKKIPKFLHSAKKF Ceropin-African clawed frog hybrid peptides Cell membrane disintegration MTT/MTS assay A-549 Lung cancer IC50 : 25 µM
dbacp02247 CA-MA2 KWKLFKKIPKFLHSAKKF Ceropin-African clawed frog hybrid peptides Cell membrane disintegration MTT/MTS assay Jurkat Blood cancer IC50 : 20 µM
dbacp02248 CA-MA2 KWKLFKKIPKFLHSAKKF Ceropin-African clawed frog hybrid peptides Cell membrane disintegration MTT/MTS assay MDA-MB-361 Breast cancer IC50 : 28 µM
dbacp02249 CA-MA3 KWKLFKKIGPGKFLHSAKKF Ceropin-African clawed frog hybrid peptides Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : >100 µM
dbacp02250 CA-MA3 KWKLFKKIGPGKFLHSAKKF Ceropin-African clawed frog hybrid peptides Cell membrane disintegration MTT/MTS assay A-549 Lung cancer IC50 : >100 µM
dbacp02251 CA-MA3 KWKLFKKIGPGKFLHSAKKF Ceropin-African clawed frog hybrid peptides Cell membrane disintegration MTT/MTS assay Jurkat Blood cancer IC50 : 75 µM
dbacp02252 CA-MA3 KWKLFKKIGPGKFLHSAKKF Ceropin-African clawed frog hybrid peptides Cell membrane disintegration MTT/MTS assay MDA-MB-361 Breast cancer IC50 : >100 µM
dbacp02342 Cecropin A KWKLFKKIKFLHSAKKF Hybrid peptide Disrupting the ionic homeostasis of the bacterium; Cell lysis Inhibition zone assay Not found Not found MIC : 0.125 - 32 mg/ml
dbacp02430 ChaC1 GDACGETCFTGICFTAGCSCNPWPTCTRN Hybrid peptide of melittin and protamine Permeabilization of the lipid membrane of the target cells Not specified Not found Not found Not found
dbacp06794 CM11 WKLFKKILKVL Cecropin-Melittin Hybrid Peptide Apoptosis inducing MTT assay Jurkat Blood Cancer Survival rate = 47% at 32 μg/ml
dbacp06795 CM11 WKLFKKILKVL Cecropin-Melittin Hybrid Peptide Apoptosis inducing MTT assay Raji Blood Cancer Survival rate = 51% at 32 μg/ml
dbacp06865 Pep-1-Phor21 CGEMGWVRCKFAKFAKKFAKFAKKFAKFAK Hybrid peptide PEP1 and Phor 21 Not available AlamarBlue assay LNCaP Liver Cancer IC50 = 55.13 ± 13.56 µM
dbacp06866 Pep-1-Phor21 CGEMGWVRCKFAKFAKKFAKFAKKFAKFAK Hybrid peptide PEP1 and Phor 21 Not available AlamarBlue assay DU-145 Prostrate Cancer IC50 = 2.57 ± 2.02 µM
dbacp06867 Pep-1-Phor21 CGEMGWVRCKFAKFAKKFAKFAKKFAKFAK Hybrid peptide PEP1 and Phor 21 Not available AlamarBlue assay PC-3 Prostrate Cancer IC50 ≤ 0.6 μM