dbACP: A Comprehensive Database of Anti-Cancer Peptides

10 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02655 Dermaseptin-B2 GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV Giant leaf frog Immunomodulatory properties Cytotoxicity assays, Cell Titer-Glo Luminescent Cell viability assay A549 Lung adenocarcinoma LC50 : < 12 μM
dbacp02656 Dermaseptin-B2 GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV Giant leaf frog Immunomodulatory properties Cytotoxicity assays, Cell Titer-Glo Luminescent Cell viability assay MDA-MB-231 Breast adenocarcinoma LC50 : < 12 μM
dbacp02657 Dermaseptin-B2 GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV Giant leaf frog Immunomodulatory properties Cytotoxicity assays, Cell Titer-Glo Luminescent Cell viability assay HT-29 Colorectal adenocarcinoma LC50 : < 12 μM
dbacp05676 Ps-1Pb IKIPSFFRNILKKVGKEAVSLIAGALKQS Merlin's dwarf gray frog Immunomodulatory properties Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay A549 Lung adenocarcinoma LC50 : < 12 μM
dbacp05677 Ps-1Pb IKIPSFFRNILKKVGKEAVSLIAGALKQS Merlin's dwarf gray frog Immunomodulatory properties Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay MDA-MB-231 Breast adenocarcinoma LC50 : < 12 μM
dbacp05678 Ps-1Pb IKIPSFFRNILKKVGKEAVSLIAGALKQS Merlin's dwarf gray frog Immunomodulatory properties Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay HT-29 Colorectal adenocarcinoma LC50 : < 12 μM
dbacp05679 Ps-2Pa GIFPIFAKLLGKVIKVASSLISKGRTE Merlin's dwarf gray frog Immunomodulatory properties Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay A549 Lung adenocarcinoma LC50 : < 12 μM
dbacp05680 Ps-2Pa GIFPIFAKLLGKVIKVASSLISKGRTE Merlin's dwarf gray frog Immunomodulatory properties Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay MDA-MB-231 Breast adenocarcinoma LC50 : < 12 μM
dbacp05681 Ps-2Pa GIFPIFAKLLGKVIKVASSLISKGRTE Merlin's dwarf gray frog Immunomodulatory properties Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay HT-29 Colorectal adenocarcinoma LC50 : < 12 μM
dbacp06133 SNX-482 GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSDOHa Giant baboon spider Immunomodulatory properties Not specified Not found Not found Not found