dbACP: A Comprehensive Database of Anti-Cancer Peptides

44 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp00704 10a NA Synthetic b2,2-amino acid derivatives Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 28 µM
dbacp00705 10b NA Synthetic b2,2-amino acid derivatives Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 11.4 µM
dbacp00706 10c NA Synthetic b2,2-amino acid derivatives Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 6.6 µM
dbacp00707 11a NA Synthetic b2,2-amino acid derivatives Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 5.2 µM
dbacp00708 11b NA Synthetic b2,2-amino acid derivatives Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 19 µM
dbacp00709 11c NA Synthetic b2,2-amino acid derivatives Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 7.2 µM
dbacp00710 12a NA Synthetic b2,2-amino acid derivatives Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 6.1 µM
dbacp00711 12b NA Synthetic b2,2-amino acid derivatives Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 27 µM
dbacp00712 12c NA Synthetic b2,2-amino acid derivatives Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 14 µM
dbacp00722 5a NA Not found Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 10.6 µM
dbacp00723 5b NA Not found Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 7.1 µM
dbacp00724 5c NA Not found Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 4.1 µM
dbacp00727 6a NA Not found Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 14.4 µM
dbacp00728 6b NA Not found Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 11.0 µM
dbacp00729 6c NA Not found Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 4.3 µM
dbacp00730 7a NA Not found Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : >63 µM
dbacp00731 7b NA Not found Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : >78 µM
dbacp00732 7c NA Not found Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 79 µM
dbacp00733 8a NA Not found Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 136 µM
dbacp00734 8b NA Not found Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : >254 µM
dbacp00735 8c NA Not found Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 107 µM
dbacp00736 9a NA Not found Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 31 µM
dbacp00737 9b NA Not found Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 2.3 µM
dbacp00738 9c NA Not found Induction of apoptosis; Disruption of cell membrane MTT/MTS assay Ramos Lymphoma cancer IC50 : 3.1 µM
dbacp02810 DP1 KLAKLAKKLAKLAK Protein transduction domain Induction of apoptosis MTT/MTS assay MCA205 Renal cancer LC50 : < 50 µM
dbacp02811 DP1 KLAKLAKKLAKLAK KLA sequence repeats, motif-based design Induction of apoptosis MTT/MTS assay MCA205 Renal cancer LC50 : < 50 µM
dbacp03373 IL-4Rα-lytic hybrid peptide KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK Interleukin-4 receptor a (IL-4Ra) chain Induction of apoptosis WST-1 assay BXPC-3 Pancreatic cancer IC50 : 6.8 µMol/L
dbacp03374 IL-4Rα-lytic hybrid peptide KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK Interleukin-4 receptor a (IL-4Ra) chain Induction of apoptosis WST-1 assay SU.86.86 Pancreatic cancer IC50 : 7.5 µMol/L
dbacp03375 IL-4Rα-lytic hybrid peptide KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK Bovine lactoferrin (Lf-B) Induction of apoptosis WST-1 assay KB Oral cancer IC50 : 13.2 µMol/L
dbacp03376 IL-4Rα-lytic hybrid peptide KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK Interleukin-4 receptor a (IL-4Ra) chain Induction of apoptosis WST-1 assay T98G Brain tumor IC50 : 18.5 µMol/L
dbacp03377 IL-4Rα-lytic hybrid peptide KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK Interleukin-4 receptor a (IL-4Ra) chain Induction of apoptosis WST-1 assay A-172 Brain tumor IC50 : 6.8 µMol/L
dbacp03378 IL-4Rα-lytic hybrid peptide KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK Interleukin-4 receptor a (IL-4Ra) chain Induction of apoptosis WST-1 assay H-322 Lung cancer IC50 : 3.6 µMol/L
dbacp03379 IL-4Rα-lytic hybrid peptide KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK Interleukin-4 receptor a (IL-4Ra) chain Induction of apoptosis WST-1 assay MDA-MB-231 Breast cancer IC50 : 5.7 µMol/L
dbacp04347 Lytic KLlLKlLkkLLKlLKKK Interleukin-4 receptor a (IL-4Ra) chain Induction of apoptosis WST-1 assay BXPC-3 Pancreatic cancer IC50 : 37.1 µMol/L
dbacp04348 Lytic KLlLKlLkkLLKlLKKK Interleukin-4 receptor a (IL-4Ra) chain Induction of apoptosis WST-1 assay SU.86.86 Pancreatic cancer IC50 : 28.0 µMol/L
dbacp04349 Lytic KLlLKlLkkLLKlLKKK Bovine lactoferrin (Lf-B) Induction of apoptosis WST-1 assay KB Oral cancer IC50 : 37.4 µMol/L
dbacp04350 Lytic KLlLKlLkkLLKlLKKK Interleukin-4 receptor a (IL-4Ra) chain Induction of apoptosis WST-1 assay T98G Brain tumor IC50 : 77.3 µMol/L
dbacp04351 Lytic KLlLKlLkkLLKlLKKK Interleukin-4 receptor a (IL-4Ra) chain Induction of apoptosis WST-1 assay A-172 Brain tumor IC50 : 30.5 µMol/L
dbacp04352 Lytic KLlLKlLkkLLKlLKKK Interleukin-4 receptor a (IL-4Ra) chain Induction of apoptosis WST-1 assay H-322 Lung cancer IC50 : 27.1 µMol/L
dbacp04353 Lytic KLlLKlLkkLLKlLKKK Interleukin-4 receptor a (IL-4Ra) chain Induction of apoptosis WST-1 assay MDA-MB-231 Breast cancer IC50 : 18.5 µMol/L
dbacp04569 Mastoparan INLKALAALAKKIL-NH2 Eusocial wasp Induction of apoptosis; Alteration of mitochondrial permeability MTS assay A549 Lung cancer IC50 : 34.3 ± 1.6 µg/mL
dbacp05222 Penaeidin-2 YRGGYTGPIPRPPPIGRPPLPRVVCACYRLSVSDARNCCIKFGSCCHLVK Pacific white shrimp Induction of apoptosis MTT assay HK-2 Kidney cancer MIC : 100 μg/mL
dbacp05223 Penaeidin-2 YRGGYTGPIPRPPPIGRPPLPRVVCACYRLSVSDARNCCIKFGSCCHLVK Pacific white shrimp Induction of apoptosis MTT assay ACHN Kidney cancer MIC : 100 μg/mL
dbacp05224 Penaeidin-2 YRGGYTGPIPRPPPIGRPPLPRVVCACYRLSVSDARNCCIKFGSCCHLVK Pacific white shrimp Induction of apoptosis MTT assay A498 Kidney cancer MIC : 100 μg/mL