44 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp00704 | 10a | NA | Synthetic b2,2-amino acid derivatives | Induction of apoptosis; Disruption of cell membrane | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 28 µM |
| dbacp00705 | 10b | NA | Synthetic b2,2-amino acid derivatives | Induction of apoptosis; Disruption of cell membrane | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 11.4 µM |
| dbacp00706 | 10c | NA | Synthetic b2,2-amino acid derivatives | Induction of apoptosis; Disruption of cell membrane | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 6.6 µM |
| dbacp00707 | 11a | NA | Synthetic b2,2-amino acid derivatives | Induction of apoptosis; Disruption of cell membrane | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 5.2 µM |
| dbacp00708 | 11b | NA | Synthetic b2,2-amino acid derivatives | Induction of apoptosis; Disruption of cell membrane | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 19 µM |
| dbacp00709 | 11c | NA | Synthetic b2,2-amino acid derivatives | Induction of apoptosis; Disruption of cell membrane | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 7.2 µM |
| dbacp00710 | 12a | NA | Synthetic b2,2-amino acid derivatives | Induction of apoptosis; Disruption of cell membrane | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 6.1 µM |
| dbacp00711 | 12b | NA | Synthetic b2,2-amino acid derivatives | Induction of apoptosis; Disruption of cell membrane | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 27 µM |
| dbacp00712 | 12c | NA | Synthetic b2,2-amino acid derivatives | Induction of apoptosis; Disruption of cell membrane | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 14 µM |
| dbacp00722 | 5a | NA | Not found | Induction of apoptosis; Disruption of cell membrane | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 10.6 µM |
| dbacp00723 | 5b | NA | Not found | Induction of apoptosis; Disruption of cell membrane | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 7.1 µM |
| dbacp00724 | 5c | NA | Not found | Induction of apoptosis; Disruption of cell membrane | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 4.1 µM |
| dbacp00727 | 6a | NA | Not found | Induction of apoptosis; Disruption of cell membrane | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 14.4 µM |
| dbacp00728 | 6b | NA | Not found | Induction of apoptosis; Disruption of cell membrane | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 11.0 µM |
| dbacp00729 | 6c | NA | Not found | Induction of apoptosis; Disruption of cell membrane | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 4.3 µM |
| dbacp00730 | 7a | NA | Not found | Induction of apoptosis; Disruption of cell membrane | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : >63 µM |
| dbacp00731 | 7b | NA | Not found | Induction of apoptosis; Disruption of cell membrane | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : >78 µM |
| dbacp00732 | 7c | NA | Not found | Induction of apoptosis; Disruption of cell membrane | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 79 µM |
| dbacp00733 | 8a | NA | Not found | Induction of apoptosis; Disruption of cell membrane | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 136 µM |
| dbacp00734 | 8b | NA | Not found | Induction of apoptosis; Disruption of cell membrane | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : >254 µM |
| dbacp00735 | 8c | NA | Not found | Induction of apoptosis; Disruption of cell membrane | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 107 µM |
| dbacp00736 | 9a | NA | Not found | Induction of apoptosis; Disruption of cell membrane | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 31 µM |
| dbacp00737 | 9b | NA | Not found | Induction of apoptosis; Disruption of cell membrane | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 2.3 µM |
| dbacp00738 | 9c | NA | Not found | Induction of apoptosis; Disruption of cell membrane | MTT/MTS assay | Ramos | Lymphoma cancer | IC50 : 3.1 µM |
| dbacp02810 | DP1 | KLAKLAKKLAKLAK | Protein transduction domain | Induction of apoptosis | MTT/MTS assay | MCA205 | Renal cancer | LC50 : < 50 µM |
| dbacp02811 | DP1 | KLAKLAKKLAKLAK | KLA sequence repeats, motif-based design | Induction of apoptosis | MTT/MTS assay | MCA205 | Renal cancer | LC50 : < 50 µM |
| dbacp03373 | IL-4Rα-lytic hybrid peptide | KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK | Interleukin-4 receptor a (IL-4Ra) chain | Induction of apoptosis | WST-1 assay | BXPC-3 | Pancreatic cancer | IC50 : 6.8 µMol/L |
| dbacp03374 | IL-4Rα-lytic hybrid peptide | KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK | Interleukin-4 receptor a (IL-4Ra) chain | Induction of apoptosis | WST-1 assay | SU.86.86 | Pancreatic cancer | IC50 : 7.5 µMol/L |
| dbacp03375 | IL-4Rα-lytic hybrid peptide | KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK | Bovine lactoferrin (Lf-B) | Induction of apoptosis | WST-1 assay | KB | Oral cancer | IC50 : 13.2 µMol/L |
| dbacp03376 | IL-4Rα-lytic hybrid peptide | KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK | Interleukin-4 receptor a (IL-4Ra) chain | Induction of apoptosis | WST-1 assay | T98G | Brain tumor | IC50 : 18.5 µMol/L |
| dbacp03377 | IL-4Rα-lytic hybrid peptide | KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK | Interleukin-4 receptor a (IL-4Ra) chain | Induction of apoptosis | WST-1 assay | A-172 | Brain tumor | IC50 : 6.8 µMol/L |
| dbacp03378 | IL-4Rα-lytic hybrid peptide | KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK | Interleukin-4 receptor a (IL-4Ra) chain | Induction of apoptosis | WST-1 assay | H-322 | Lung cancer | IC50 : 3.6 µMol/L |
| dbacp03379 | IL-4Rα-lytic hybrid peptide | KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK | Interleukin-4 receptor a (IL-4Ra) chain | Induction of apoptosis | WST-1 assay | MDA-MB-231 | Breast cancer | IC50 : 5.7 µMol/L |
| dbacp04347 | Lytic | KLlLKlLkkLLKlLKKK | Interleukin-4 receptor a (IL-4Ra) chain | Induction of apoptosis | WST-1 assay | BXPC-3 | Pancreatic cancer | IC50 : 37.1 µMol/L |
| dbacp04348 | Lytic | KLlLKlLkkLLKlLKKK | Interleukin-4 receptor a (IL-4Ra) chain | Induction of apoptosis | WST-1 assay | SU.86.86 | Pancreatic cancer | IC50 : 28.0 µMol/L |
| dbacp04349 | Lytic | KLlLKlLkkLLKlLKKK | Bovine lactoferrin (Lf-B) | Induction of apoptosis | WST-1 assay | KB | Oral cancer | IC50 : 37.4 µMol/L |
| dbacp04350 | Lytic | KLlLKlLkkLLKlLKKK | Interleukin-4 receptor a (IL-4Ra) chain | Induction of apoptosis | WST-1 assay | T98G | Brain tumor | IC50 : 77.3 µMol/L |
| dbacp04351 | Lytic | KLlLKlLkkLLKlLKKK | Interleukin-4 receptor a (IL-4Ra) chain | Induction of apoptosis | WST-1 assay | A-172 | Brain tumor | IC50 : 30.5 µMol/L |
| dbacp04352 | Lytic | KLlLKlLkkLLKlLKKK | Interleukin-4 receptor a (IL-4Ra) chain | Induction of apoptosis | WST-1 assay | H-322 | Lung cancer | IC50 : 27.1 µMol/L |
| dbacp04353 | Lytic | KLlLKlLkkLLKlLKKK | Interleukin-4 receptor a (IL-4Ra) chain | Induction of apoptosis | WST-1 assay | MDA-MB-231 | Breast cancer | IC50 : 18.5 µMol/L |
| dbacp04569 | Mastoparan | INLKALAALAKKIL-NH2 | Eusocial wasp | Induction of apoptosis; Alteration of mitochondrial permeability | MTS assay | A549 | Lung cancer | IC50 : 34.3 ± 1.6 µg/mL |
| dbacp05222 | Penaeidin-2 | YRGGYTGPIPRPPPIGRPPLPRVVCACYRLSVSDARNCCIKFGSCCHLVK | Pacific white shrimp | Induction of apoptosis | MTT assay | HK-2 | Kidney cancer | MIC : 100 μg/mL |
| dbacp05223 | Penaeidin-2 | YRGGYTGPIPRPPPIGRPPLPRVVCACYRLSVSDARNCCIKFGSCCHLVK | Pacific white shrimp | Induction of apoptosis | MTT assay | ACHN | Kidney cancer | MIC : 100 μg/mL |
| dbacp05224 | Penaeidin-2 | YRGGYTGPIPRPPPIGRPPLPRVVCACYRLSVSDARNCCIKFGSCCHLVK | Pacific white shrimp | Induction of apoptosis | MTT assay | A498 | Kidney cancer | MIC : 100 μg/mL |