dbACP: A Comprehensive Database of Anti-Cancer Peptides

1 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp05138 Pardaxin 4 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Red sea moses sole Interference with ionic transport of the osmoregulatory system in epithelium causing cell lysis Not specified Not found Not found Not found