3 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp06130 | Smp24 | ILQDIWNGIKNLF-NH | Israeli gold scorpion | Disrupt the structure and function of cell membranes | ATP release assay | HepG3 | Liver cancer | MIC : 94.8% (±7.5) at 512 μg/ml |
| dbacp06131 | Smp24 | IWSFLIKAATKLLPSLFGGGKKDS | Venom, Israeli Gold Scorpion | Disrupt the structure and function of cell membranes | ATP release assay | HepG2 | Liver cancer | MIC : 32 μg/ml |
| dbacp06132 | Smp43 | GVWDWIKKTAGKIWNSEPVKALKSQALNAAKNFVAEKIGATPS | Venom, Israeli Gold Scorpion | Disrupt the structure and function of cell membranes | ATP release assay | HepG2 | Liver cancer | MIC : 512 μg/ml |