dbACP: A Comprehensive Database of Anti-Cancer Peptides

3 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp06130 Smp24 ILQDIWNGIKNLF-NH Israeli gold scorpion Disrupt the structure and function of cell membranes ATP release assay HepG3 Liver cancer MIC : 94.8% (±7.5) at 512 μg/ml
dbacp06131 Smp24 IWSFLIKAATKLLPSLFGGGKKDS Venom, Israeli Gold Scorpion Disrupt the structure and function of cell membranes ATP release assay HepG2 Liver cancer MIC : 32 μg/ml
dbacp06132 Smp43 GVWDWIKKTAGKIWNSEPVKALKSQALNAAKNFVAEKIGATPS Venom, Israeli Gold Scorpion Disrupt the structure and function of cell membranes ATP release assay HepG2 Liver cancer MIC : 512 μg/ml