dbACP: A Comprehensive Database of Anti-Cancer Peptides

1 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp05658 Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV Human Cytotoxic effects SDS-PAGE assay Jurcat Colorectal cancer Not found