131 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp00347 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 6.4 ± 0.6 μM |
| dbacp00348 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid Leukemia | CC50 : 6.4 ± 0.6 μM |
| dbacp00349 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 6.4 ± 0.6 μM |
| dbacp00350 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 6.4 ± 0.6 μM |
| dbacp00351 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 6.4 ± 0.6 μM |
| dbacp00387 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 1.4 ± 0.2 μM |
| dbacp00388 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid Leukemia | CC50 : 1.4 ± 0.2 μM |
| dbacp00389 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 1.4 ± 0.2 μM |
| dbacp00390 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 1.4 ± 0.2 μM |
| dbacp00391 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 1.4 ± 0.2 μM |
| dbacp00423 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 3.9 ± 0.2 μM |
| dbacp00424 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid Leukemia | CC50 : 3.9 ± 0.2 μM |
| dbacp00425 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 3.9 ± 0.2 μM |
| dbacp00426 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 3.9 ± 0.2 μM |
| dbacp00427 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 3.9 ± 0.2 μM |
| dbacp00465 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 2.1 ± 0.2 μM |
| dbacp00466 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid Leukemia | CC50 : 2.1 ± 0.2 μM |
| dbacp00467 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 2.1 ± 0.2 μM |
| dbacp00468 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 2.1 ± 0.2 μM |
| dbacp00469 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 2.1 ± 0.2 μM |
| dbacp00505 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 1.3 ± 0.1 μM |
| dbacp00506 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid Leukemia | CC50 : 1.3 ± 0.1 μM |
| dbacp00507 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 1.3 ± 0.1 μM |
| dbacp00508 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 1.3 ± 0.1 μM |
| dbacp00509 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 1.3 ± 0.1 μM |
| dbacp00540 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 3.1 ± 0.1 μM |
| dbacp00541 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid Leukemia | CC50 : 3.1 ± 0.1 μM |
| dbacp00542 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 3.1 ± 0.1 μM |
| dbacp00543 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 3.1 ± 0.1 μM |
| dbacp00544 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 3.1 ± 0.1 μM |
| dbacp00565 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 1.0 ± 0.1 μM |
| dbacp00566 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid Leukemia | CC50 : 1.0 ± 0.1 μM |
| dbacp00567 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 1.0 ± 0.1 μM |
| dbacp00568 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 1.0 ± 0.1 μM |
| dbacp00569 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 1.0 ± 0.1 μM |
| dbacp00572 | [L9]-P18 | KWKLFKKILKFLHLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 3 µM |
| dbacp00598 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 11.5 ± 0.6 μM |
| dbacp00599 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid Leukemia | CC50 : 11.5 ± 0.6 μM |
| dbacp00600 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 11.5 ± 0.6 μM |
| dbacp00601 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 11.5 ± 0.6 μM |
| dbacp00602 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 11.5 ± 0.6 μM |
| dbacp00620 | [S9]-P18 | KWKLFKKISKFLHLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 3 µM |
| dbacp00641 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 2.7 ± 0.1 μM |
| dbacp00642 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid Leukemia | CC50 : 2.7 ± 0.1 μM |
| dbacp00643 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 2.7 ± 0.1 μM |
| dbacp00644 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 2.7 ± 0.1 μM |
| dbacp00645 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 2.7 ± 0.1 μM |
| dbacp00671 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 3.9 ± 0.1 μM |
| dbacp00672 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid Leukemia | CC50 : 3.9 ± 0.1 μM |
| dbacp00673 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 3.9 ± 0.1 μM |
| dbacp00674 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 3.9 ± 0.1 μM |
| dbacp00675 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 3.9 ± 0.1 μM |
| dbacp00696 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 3.9 ± 0.2 μM |
| dbacp00697 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid Leukemia | CC50 : 3.9 ± 0.2 μM |
| dbacp00698 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 3.9 ± 0.2 μM |
| dbacp00699 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 3.9 ± 0.2 μM |
| dbacp00700 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 3.9 ± 0.2 μM |
| dbacp01329 | Aurein-2.5 | GLFDIVKKVVGAFGSL | Green and golden bell frog | Cell membrane disintegration | One-dose and five-dose assay | K-562 | Leukemia | IC50 : 4-5 μM |
| dbacp01991 | Buforin IIb | RAGLQFPVGRLLRRLLRRLLR | Histone H2A | Inducing mitochondria-dependent apoptosis | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 8.2 µg/ml |
| dbacp02115 | C-1 | KWKLFKKIPFLHLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 31 µM |
| dbacp02118 | C-10 | KWKLFKKIPKFLH | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : <100 µM |
| dbacp02121 | C-2 | KWKLFKKIPKFLHLAKK | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 23 µM |
| dbacp02124 | C-3 | KWKLFKKIPLHLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 62 µM |
| dbacp02127 | C-4 | KWKLFKKIPKFLHLAK | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 25 µM |
| dbacp02130 | C-5 | KWKLFKKIPHLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 67 µM |
| dbacp02133 | C-6 | KWKLFKKIPKFLHLA | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 27 µM |
| dbacp02136 | C-7 | KWKLFKKIPLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : <100 µM |
| dbacp02139 | C-8 | KWKLFKKIPKFLHL | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 30 µM |
| dbacp02142 | C-9 | KWKLFKKIPLKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : <100 µM |
| dbacp02231 | CA-MA | KWKLFKKIGIGKFLHSAKKF | Ceropin-African clawed frog hybrid peptides | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 65 µM |
| dbacp02240 | CA-MA-P | KWKLFKKIPKFLHSAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 25 µM |
| dbacp02241 | CA-MA1 | KWKLFKKIKFLHSAKKF | Ceropin-African clawed frog hybrid peptides | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 85.3 µM |
| dbacp02245 | CA-MA2 | KWKLFKKIPKFLHSAKKF | Ceropin-African clawed frog hybrid peptides | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 35.1 µM |
| dbacp02249 | CA-MA3 | KWKLFKKIGPGKFLHSAKKF | Ceropin-African clawed frog hybrid peptides | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : >100 µM |
| dbacp02357 | Cecropin B | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL | Silkmoth | Pore formation at the cytoplasmic membrane | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 15.5 µM |
| dbacp02371 | Cecropin P1 | SWLSKTAKKLENSAKKRISEGIAIAIQGGPR | Small Intestine of Pig | Pore formation at the cytoplasmic membrane | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 93 µM |
| dbacp02420 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 2.7 ± 0.1 μM |
| dbacp02421 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid leukemia | CC50 : 2.7 ± 0.1 μM |
| dbacp02422 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 2.7 ± 0.1 μM |
| dbacp02423 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 2.7 ± 0.1 μM |
| dbacp02424 | cGm (Derived from Gm) | GCRRLCYKQRCVTYCRGR | Synthetic construct | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 2.7 ± 0.1 μM |
| dbacp02564 | CRAMP-18 E2K | GKKLKKIGQKIKNFFQKL | Synthetic | Disrupt cell membrane structure | MTT assay | K-562 | Chronic myelogenous Leukemia | IC50 : 20–34 uM |
| dbacp03126 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Fluorescence-based assay using a Fluorescence Imaging Plate Reader | K-562 | Chronic myeloid leukemia | CC50 : 3.8 ± 0.3 μM |
| dbacp03129 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Epithelial cancer | CC50 : 3.8 ± 0.3 μM |
| dbacp03130 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Chronic myeloid leukemia | CC50 : 3.8 ± 0.3 μM |
| dbacp03131 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Gastric cancer | CC50 : 3.8 ± 0.3 μM |
| dbacp03132 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Breast cancer | CC50 : 3.8 ± 0.3 μM |
| dbacp03133 | Gomesin | ZCRRLCYKQRCVTYCRGR | Tarantula spider sp. | Target and destroy tumor cell membranes | Cell viability assay | K-562 | Cervical cancer | CC50 : 3.8 ± 0.3 μM |
| dbacp04291 | Lt-MAP2 | LIKKLKEYLKKLI | Derivatives of Latarcin-3a | Not specified | Not specified | K-562 | Not found | Not found |
| dbacp04493 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | K-562 | Leukemia cancer | IC50 : >150 µg/ml |
| dbacp04511 | Magainin A | AIGKFLHSAKKFGKAFVGEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | K-562 | Leukemia cancer | IC50 : 40 µg/ml |
| dbacp04521 | Magainin B | GIGKFLHAAKKFAKAFVAEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | K-562 | Leukemia cancer | IC50 : 32 µg/ml |
| dbacp04537 | Magainin G | GIGKFLHSAKKFAKAFVAEIMNS | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | K-562 | Leukemia cancer | IC50 :37 µg/ml |
| dbacp04732 | N-1 | WKLFKKIPKFLHLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 6 µM |
| dbacp04735 | N-2 | FKLFKKIPKFLHLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 7 µM |
| dbacp04738 | N-3 | KWFKKIPKFLHLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 11 µM |
| dbacp04741 | N-3L | KWFKKIPKFLHLLKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 4.2 µM |
| dbacp04744 | N-4 | WFKKIPKFLHLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 24 µM |
| dbacp04747 | N-4L | WFKKIPKFLHLLKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 3 µM |
| dbacp04750 | N-5 | WKKIPKFLHLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : < 100 µM |
| dbacp04753 | N-5L | WKKIPKFLHLLKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 :10 µM |
| dbacp05050 | P18 | KWKFKKIPKFLHLAKKF | Ceropin A | Cell membrane disintegration | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 3.5 µM |
| dbacp06075 | Shiva-1 | MPRWRLFRRIDRVGKQIKQGILRAGPAIALVGDARAVG | African clawed frog | Pore formation at the cytoplasmic membrane | MTT/MTS assay | K-562 | Leukemia cancer | IC50 : 28.7 µM |
| dbacp06563 | Z24 | ALSKALSKALSKALSKALSKALSK | African clawed frog | Dissipate ion gradients; Induce osmotic lysis; Membrane damage | Trypan blue assay | K-562 | Leukemia cancer | IC50 : 112 µg/ml |
| dbacp06579 | Z44 | ALSKALSKALSKALSKALSKALSK | African clawed frog | Dissipate ion gradients;Induce osmotic lysis; Membrane damage | Trypan blue assay | K-562 | Leukemia cancer | IC50 : 98 µg/ml |
| dbacp06807 | [C/U, G1K, L5Y, K8R]cGm | KURRYUYRQRUVTYURGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 6.4 ± 0.6 μM |
| dbacp06813 | [G1K, L5Y, K8R]cGm | KCRRYCYRQRCVTYCRGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 1.3 ± 0.1 μM |
| dbacp06818 | [D-P L-P]cGm | GCRRLCYKQRCVTYCRGpPR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 3.9 ± 0.2 μM |
| dbacp06823 | [C/U]cGm | GURRLUYKQRUVTYURGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 1.4 ± 0.2 μM |
| dbacp06829 | [G1K, K8R]cGm | KCRRLCYRQRCVTYCRGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 2.1 ± 0.2 μM |
| dbacp06835 | [R4A, R18A]cGm | GCRALCYKQRCVTYCRGA | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 11.5 ± 0.6 μM |
| dbacp06841 | [Y7W, K8R, Y14W]cGm | GCRRLCWRQRCVTWCRGR | Synthetic Analogue of Gomesin | Cell membrane penetration | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 3.9 ± 0.1 μM |
| dbacp07807 | cT1 | KWCFRVCYRGICYRRCRG | Synthetic | Not Available | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 2.0 ± 0.1 µM |
| dbacp07812 | [R/K]cT1 | KWCFKVCYKGICYKKCKG | Synthetic | Not Available | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 2.5 ± 0.1 µM |
| dbacp07818 | [W2S]cT1 | KSCFRVCYRGICYRRCRG | Synthetic | Not Available | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 2.7 ± 0.2 µM |
| dbacp07823 | [Y8S-I11S]cT1 | KWCFRVCSRGSCYRRCRG | Synthetic | Not Available | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 13.2 ± 0.9 µM |
| dbacp07837 | [R9S-R14S-R17S]cT1 | KWCFRVCYSGICYSRCSG | Synthetic | Not Available | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 4.8 ± 0.3 µM |
| dbacp07841 | [G18K]cT1 | KWCFRVCYRGICYRRCRK | Synthetic | Not Available | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 1.7 ± 0.1 µM |
| dbacp07846 | [I11F-G18K]cT1 | KWCFRVCYRGFCYRRCRK | Synthetic | Not Available | Resazurin dye assay | K-562 | Leukemia Cancer | CC50 = 1.9 ± 0.1 µM |
| dbacp08089 | B1 | KKLFKKILKYLK | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | K-562 | Leukemia Cancer | IC50 = 17.9 ± 1.4 μM |
| dbacp08092 | B1 | KKLFKKILKYLK | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | K-562/ADM | Leukemia Cancer | IC50 = 19.1 ± 2.1 μM |
| dbacp08093 | B2 | KKLFKKILKYLKK | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | K-562 | Leukemia Cancer | IC50 = 33.6 ± 4.2 μM |
| dbacp08096 | B2 | KKLFKKILKYLKK | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | K-562/ADM | Leukemia Cancer | IC50 = 39.6 ± 5.7 μM |
| dbacp08097 | B3 | KKLFKKILKYLKKL | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | K-562 | Leukemia Cancer | IC50 = 47.4 ± 12.5 μM |
| dbacp08100 | B5 | LKKLFKKILKYLK | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | K-562 | Leukemia Cancer | IC50 = 26.5 ± 1.5 μM |
| dbacp08103 | B5 | LKKLFKKILKYLK | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | K-562/ADM | Leukemia Cancer | IC50 = 28.3 ± 2.3 μM |
| dbacp08104 | B6 | LKKLFKKILKYLKK | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | K-562 | Leukemia Cancer | IC50 = 19.2 ± 2.3 μM |
| dbacp08107 | B6 | LKKLFKKILKYLKK | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | K-562/ADM | Leukemia Cancer | IC50 = 22.7 ± 2.3 μM |
| dbacp08108 | B9 | KLKKLFKKILKY | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | K-562 | Leukemia Cancer | IC50 = 60.7 ± 5.4 μM |
| dbacp08111 | B9 | KLKKLFKKILKY | Analogue of BP 100 | Membrane disruption triggers apoptosis | MTT assay | K-562/ADM | Leukemia Cancer | IC50 = 83.7 ± 5.3 μM |
| dbacp08427 | 5-2C | NYPQRPCRGDKGPDC | Synthetic | Not Available | MTT assay | K-562 | Blood Cancer | IC50 = 1.103 μM |