dbACP: A Comprehensive Database of Anti-Cancer Peptides

131 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp00347 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 6.4 ± 0.6 μM
dbacp00348 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 6.4 ± 0.6 μM
dbacp00349 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 6.4 ± 0.6 μM
dbacp00350 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 6.4 ± 0.6 μM
dbacp00351 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 6.4 ± 0.6 μM
dbacp00387 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 1.4 ± 0.2 μM
dbacp00388 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 1.4 ± 0.2 μM
dbacp00389 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 1.4 ± 0.2 μM
dbacp00390 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 1.4 ± 0.2 μM
dbacp00391 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 1.4 ± 0.2 μM
dbacp00423 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 3.9 ± 0.2 μM
dbacp00424 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 3.9 ± 0.2 μM
dbacp00425 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 3.9 ± 0.2 μM
dbacp00426 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 3.9 ± 0.2 μM
dbacp00427 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 3.9 ± 0.2 μM
dbacp00465 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 2.1 ± 0.2 μM
dbacp00466 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 2.1 ± 0.2 μM
dbacp00467 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 2.1 ± 0.2 μM
dbacp00468 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 2.1 ± 0.2 μM
dbacp00469 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 2.1 ± 0.2 μM
dbacp00505 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 1.3 ± 0.1 μM
dbacp00506 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 1.3 ± 0.1 μM
dbacp00507 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 1.3 ± 0.1 μM
dbacp00508 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 1.3 ± 0.1 μM
dbacp00509 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 1.3 ± 0.1 μM
dbacp00540 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 3.1 ± 0.1 μM
dbacp00541 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 3.1 ± 0.1 μM
dbacp00542 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 3.1 ± 0.1 μM
dbacp00543 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 3.1 ± 0.1 μM
dbacp00544 [K8R]cGm GCRRLCYRQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 3.1 ± 0.1 μM
dbacp00565 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 1.0 ± 0.1 μM
dbacp00566 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 1.0 ± 0.1 μM
dbacp00567 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 1.0 ± 0.1 μM
dbacp00568 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 1.0 ± 0.1 μM
dbacp00569 [L5W]cGm GCRRWCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 1.0 ± 0.1 μM
dbacp00572 [L9]-P18 KWKLFKKILKFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 3 µM
dbacp00598 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 11.5 ± 0.6 μM
dbacp00599 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 11.5 ± 0.6 μM
dbacp00600 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 11.5 ± 0.6 μM
dbacp00601 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 11.5 ± 0.6 μM
dbacp00602 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 11.5 ± 0.6 μM
dbacp00620 [S9]-P18 KWKLFKKISKFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 3 µM
dbacp00641 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 2.7 ± 0.1 μM
dbacp00642 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 2.7 ± 0.1 μM
dbacp00643 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 2.7 ± 0.1 μM
dbacp00644 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 2.7 ± 0.1 μM
dbacp00645 [Y14W]cGm GCRRLCYKQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 2.7 ± 0.1 μM
dbacp00671 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 3.9 ± 0.1 μM
dbacp00672 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 3.9 ± 0.1 μM
dbacp00673 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 3.9 ± 0.1 μM
dbacp00674 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 3.9 ± 0.1 μM
dbacp00675 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 3.9 ± 0.1 μM
dbacp00696 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 3.9 ± 0.2 μM
dbacp00697 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid Leukemia CC50 : 3.9 ± 0.2 μM
dbacp00698 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 3.9 ± 0.2 μM
dbacp00699 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 3.9 ± 0.2 μM
dbacp00700 [Y7W]cGm GCRRLCWKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 3.9 ± 0.2 μM
dbacp01329 Aurein-2.5 GLFDIVKKVVGAFGSL Green and golden bell frog Cell membrane disintegration One-dose and five-dose assay K-562 Leukemia IC50 : 4-5 μM
dbacp01991 Buforin IIb RAGLQFPVGRLLRRLLRRLLR Histone H2A Inducing mitochondria-dependent apoptosis MTT/MTS assay K-562 Leukemia cancer IC50 : 8.2 µg/ml
dbacp02115 C-1 KWKLFKKIPFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 31 µM
dbacp02118 C-10 KWKLFKKIPKFLH Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : <100 µM
dbacp02121 C-2 KWKLFKKIPKFLHLAKK Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 23 µM
dbacp02124 C-3 KWKLFKKIPLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 62 µM
dbacp02127 C-4 KWKLFKKIPKFLHLAK Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 25 µM
dbacp02130 C-5 KWKLFKKIPHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 67 µM
dbacp02133 C-6 KWKLFKKIPKFLHLA Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 27 µM
dbacp02136 C-7 KWKLFKKIPLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : <100 µM
dbacp02139 C-8 KWKLFKKIPKFLHL Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 30 µM
dbacp02142 C-9 KWKLFKKIPLKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : <100 µM
dbacp02231 CA-MA KWKLFKKIGIGKFLHSAKKF Ceropin-African clawed frog hybrid peptides Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 65 µM
dbacp02240 CA-MA-P KWKLFKKIPKFLHSAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 25 µM
dbacp02241 CA-MA1 KWKLFKKIKFLHSAKKF Ceropin-African clawed frog hybrid peptides Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 85.3 µM
dbacp02245 CA-MA2 KWKLFKKIPKFLHSAKKF Ceropin-African clawed frog hybrid peptides Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 35.1 µM
dbacp02249 CA-MA3 KWKLFKKIGPGKFLHSAKKF Ceropin-African clawed frog hybrid peptides Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : >100 µM
dbacp02357 Cecropin B KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL Silkmoth Pore formation at the cytoplasmic membrane MTT/MTS assay K-562 Leukemia cancer IC50 : 15.5 µM
dbacp02371 Cecropin P1 SWLSKTAKKLENSAKKRISEGIAIAIQGGPR Small Intestine of Pig Pore formation at the cytoplasmic membrane MTT/MTS assay K-562 Leukemia cancer IC50 : 93 µM
dbacp02420 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 2.7 ± 0.1 μM
dbacp02421 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid leukemia CC50 : 2.7 ± 0.1 μM
dbacp02422 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 2.7 ± 0.1 μM
dbacp02423 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 2.7 ± 0.1 μM
dbacp02424 cGm (Derived from Gm) GCRRLCYKQRCVTYCRGR Synthetic construct Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 2.7 ± 0.1 μM
dbacp02564 CRAMP-18 E2K GKKLKKIGQKIKNFFQKL Synthetic Disrupt cell membrane structure MTT assay K-562 Chronic myelogenous Leukemia IC50 : 20–34 uM
dbacp03126 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Fluorescence-based assay using a Fluorescence Imaging Plate Reader K-562 Chronic myeloid leukemia CC50 : 3.8 ± 0.3 μM
dbacp03129 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay K-562 Epithelial cancer CC50 : 3.8 ± 0.3 μM
dbacp03130 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay K-562 Chronic myeloid leukemia CC50 : 3.8 ± 0.3 μM
dbacp03131 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay K-562 Gastric cancer CC50 : 3.8 ± 0.3 μM
dbacp03132 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay K-562 Breast cancer CC50 : 3.8 ± 0.3 μM
dbacp03133 Gomesin ZCRRLCYKQRCVTYCRGR Tarantula spider sp. Target and destroy tumor cell membranes Cell viability assay K-562 Cervical cancer CC50 : 3.8 ± 0.3 μM
dbacp04291 Lt-MAP2 LIKKLKEYLKKLI Derivatives of Latarcin-3a Not specified Not specified K-562 Not found Not found
dbacp04493 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay K-562 Leukemia cancer IC50 : >150 µg/ml
dbacp04511 Magainin A AIGKFLHSAKKFGKAFVGEIMNS African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay K-562 Leukemia cancer IC50 : 40 µg/ml
dbacp04521 Magainin B GIGKFLHAAKKFAKAFVAEIMNS African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay K-562 Leukemia cancer IC50 : 32 µg/ml
dbacp04537 Magainin G GIGKFLHSAKKFAKAFVAEIMNS African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay K-562 Leukemia cancer IC50 :37 µg/ml
dbacp04732 N-1 WKLFKKIPKFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 6 µM
dbacp04735 N-2 FKLFKKIPKFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 7 µM
dbacp04738 N-3 KWFKKIPKFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 11 µM
dbacp04741 N-3L KWFKKIPKFLHLLKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 4.2 µM
dbacp04744 N-4 WFKKIPKFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 24 µM
dbacp04747 N-4L WFKKIPKFLHLLKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 3 µM
dbacp04750 N-5 WKKIPKFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : < 100 µM
dbacp04753 N-5L WKKIPKFLHLLKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 :10 µM
dbacp05050 P18 KWKFKKIPKFLHLAKKF Ceropin A Cell membrane disintegration MTT/MTS assay K-562 Leukemia cancer IC50 : 3.5 µM
dbacp06075 Shiva-1 MPRWRLFRRIDRVGKQIKQGILRAGPAIALVGDARAVG African clawed frog Pore formation at the cytoplasmic membrane MTT/MTS assay K-562 Leukemia cancer IC50 : 28.7 µM
dbacp06563 Z24 ALSKALSKALSKALSKALSKALSK African clawed frog Dissipate ion gradients; Induce osmotic lysis; Membrane damage Trypan blue assay K-562 Leukemia cancer IC50 : 112 µg/ml
dbacp06579 Z44 ALSKALSKALSKALSKALSKALSK African clawed frog Dissipate ion gradients;Induce osmotic lysis; Membrane damage Trypan blue assay K-562 Leukemia cancer IC50 : 98 µg/ml
dbacp06807 [C/U, G1K, L5Y, K8R]cGm KURRYUYRQRUVTYURGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay K-562 Leukemia Cancer CC50 = 6.4 ± 0.6 μM
dbacp06813 [G1K, L5Y, K8R]cGm KCRRYCYRQRCVTYCRGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay K-562 Leukemia Cancer CC50 = 1.3 ± 0.1 μM
dbacp06818 [D-P L-P]cGm GCRRLCYKQRCVTYCRGpPR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay K-562 Leukemia Cancer CC50 = 3.9 ± 0.2 μM
dbacp06823 [C/U]cGm GURRLUYKQRUVTYURGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay K-562 Leukemia Cancer CC50 = 1.4 ± 0.2 μM
dbacp06829 [G1K, K8R]cGm KCRRLCYRQRCVTYCRGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay K-562 Leukemia Cancer CC50 = 2.1 ± 0.2 μM
dbacp06835 [R4A, R18A]cGm GCRALCYKQRCVTYCRGA Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay K-562 Leukemia Cancer CC50 = 11.5 ± 0.6 μM
dbacp06841 [Y7W, K8R, Y14W]cGm GCRRLCWRQRCVTWCRGR Synthetic Analogue of Gomesin Cell membrane penetration Resazurin dye assay K-562 Leukemia Cancer CC50 = 3.9 ± 0.1 μM
dbacp07807 cT1 KWCFRVCYRGICYRRCRG Synthetic Not Available Resazurin dye assay K-562 Leukemia Cancer CC50 = 2.0 ± 0.1 µM
dbacp07812 [R/K]cT1 KWCFKVCYKGICYKKCKG Synthetic Not Available Resazurin dye assay K-562 Leukemia Cancer CC50 = 2.5 ± 0.1 µM
dbacp07818 [W2S]cT1 KSCFRVCYRGICYRRCRG Synthetic Not Available Resazurin dye assay K-562 Leukemia Cancer CC50 = 2.7 ± 0.2 µM
dbacp07823 [Y8S-I11S]cT1 KWCFRVCSRGSCYRRCRG Synthetic Not Available Resazurin dye assay K-562 Leukemia Cancer CC50 = 13.2 ± 0.9 µM
dbacp07837 [R9S-R14S-R17S]cT1 KWCFRVCYSGICYSRCSG Synthetic Not Available Resazurin dye assay K-562 Leukemia Cancer CC50 = 4.8 ± 0.3 µM
dbacp07841 [G18K]cT1 KWCFRVCYRGICYRRCRK Synthetic Not Available Resazurin dye assay K-562 Leukemia Cancer CC50 = 1.7 ± 0.1 µM
dbacp07846 [I11F-G18K]cT1 KWCFRVCYRGFCYRRCRK Synthetic Not Available Resazurin dye assay K-562 Leukemia Cancer CC50 = 1.9 ± 0.1 µM
dbacp08089 B1 KKLFKKILKYLK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562 Leukemia Cancer IC50 = 17.9 ± 1.4 μM
dbacp08092 B1 KKLFKKILKYLK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562/ADM Leukemia Cancer IC50 = 19.1 ± 2.1 μM
dbacp08093 B2 KKLFKKILKYLKK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562 Leukemia Cancer IC50 = 33.6 ± 4.2 μM
dbacp08096 B2 KKLFKKILKYLKK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562/ADM Leukemia Cancer IC50 = 39.6 ± 5.7 μM
dbacp08097 B3 KKLFKKILKYLKKL Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562 Leukemia Cancer IC50 = 47.4 ± 12.5 μM
dbacp08100 B5 LKKLFKKILKYLK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562 Leukemia Cancer IC50 = 26.5 ± 1.5 μM
dbacp08103 B5 LKKLFKKILKYLK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562/ADM Leukemia Cancer IC50 = 28.3 ± 2.3 μM
dbacp08104 B6 LKKLFKKILKYLKK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562 Leukemia Cancer IC50 = 19.2 ± 2.3 μM
dbacp08107 B6 LKKLFKKILKYLKK Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562/ADM Leukemia Cancer IC50 = 22.7 ± 2.3 μM
dbacp08108 B9 KLKKLFKKILKY Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562 Leukemia Cancer IC50 = 60.7 ± 5.4 μM
dbacp08111 B9 KLKKLFKKILKY Analogue of BP 100 Membrane disruption triggers apoptosis MTT assay K-562/ADM Leukemia Cancer IC50 = 83.7 ± 5.3 μM
dbacp08427 5-2C NYPQRPCRGDKGPDC Synthetic Not Available MTT assay K-562 Blood Cancer IC50 = 1.103 μM