dbACP: A Comprehensive Database of Anti-Cancer Peptides

2 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp01193 ATAP-iRGD peptide-Parental KFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC Anti apoptotic (MCL-1, BFL1) Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 : 1.6 μM
dbacp01199 ATAP-iRGD-M7 KFEPKSGWMTFLEVTGKIAEMLSLLKQYCRGDKGPDC Anti apoptotic (MCL-1, BFL1) Inducing apoptosis MTT assay DU-145 Prostate cancer IC50 : 2.1 μM