dbACP: A Comprehensive Database of Anti-Cancer Peptides

2 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp06520 Viscotoxin A2 KSCCPNTTGRNIYNTCRFGGGSRQVCASLSGCKIISASTCPSDYPK European mistletoe Cell membrane disintegration Not specified Not found Colorectal cancer Not found
dbacp06521 Viscotoxin A2 KSCCPNTTGRNIYNTCRFGGGSRQVCASLSGCKIISASTCPSDYPK European mistletoe Cell membrane disintegration Not specified Not found Colorectal cancer Not found