dbACP: A Comprehensive Database of Anti-Cancer Peptides

6 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp05222 Penaeidin-2 YRGGYTGPIPRPPPIGRPPLPRVVCACYRLSVSDARNCCIKFGSCCHLVK Pacific white shrimp Induction of apoptosis MTT assay HK-2 Kidney cancer MIC : 100 μg/mL
dbacp05223 Penaeidin-2 YRGGYTGPIPRPPPIGRPPLPRVVCACYRLSVSDARNCCIKFGSCCHLVK Pacific white shrimp Induction of apoptosis MTT assay ACHN Kidney cancer MIC : 100 μg/mL
dbacp05224 Penaeidin-2 YRGGYTGPIPRPPPIGRPPLPRVVCACYRLSVSDARNCCIKFGSCCHLVK Pacific white shrimp Induction of apoptosis MTT assay A498 Kidney cancer MIC : 100 μg/mL
dbacp06127 SK84 SQLGDLGSGAGQGGGGGGSIRAAGGAFGKLEAAREEEFFYKKQKEQLERLKNDQIHQAEFHHQQIKEHEEAIQRHKDFLNNLHK Fruit fly Destroying the cell membranes Cell proliferation assay HEK29 Kidney cancer MIC : 4 – 8 mM
dbacp06328 Transactivator of transcript-DV1-Bcl-2, AT-DV1-BH3 RRRQRRKKRGGGGLGASWHRPDK Transactivator of transcript-DV1-Bcl-2 TAT-DV1-BH5 Apoptosis inducing Cell viability assay, Transwell invasion assay HEK-293 Kidney cancer Not specified
dbacp08271 ZXR-2 FKIGGFIKKLWRSLLA Synthetic Not Available MTT assay 293T Kidney Cancer IC50 = 6.3 ± 0.7 μM