6 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp05222 | Penaeidin-2 | YRGGYTGPIPRPPPIGRPPLPRVVCACYRLSVSDARNCCIKFGSCCHLVK | Pacific white shrimp | Induction of apoptosis | MTT assay | HK-2 | Kidney cancer | MIC : 100 μg/mL |
| dbacp05223 | Penaeidin-2 | YRGGYTGPIPRPPPIGRPPLPRVVCACYRLSVSDARNCCIKFGSCCHLVK | Pacific white shrimp | Induction of apoptosis | MTT assay | ACHN | Kidney cancer | MIC : 100 μg/mL |
| dbacp05224 | Penaeidin-2 | YRGGYTGPIPRPPPIGRPPLPRVVCACYRLSVSDARNCCIKFGSCCHLVK | Pacific white shrimp | Induction of apoptosis | MTT assay | A498 | Kidney cancer | MIC : 100 μg/mL |
| dbacp06127 | SK84 | SQLGDLGSGAGQGGGGGGSIRAAGGAFGKLEAAREEEFFYKKQKEQLERLKNDQIHQAEFHHQQIKEHEEAIQRHKDFLNNLHK | Fruit fly | Destroying the cell membranes | Cell proliferation assay | HEK29 | Kidney cancer | MIC : 4 – 8 mM |
| dbacp06328 | Transactivator of transcript-DV1-Bcl-2, AT-DV1-BH3 | RRRQRRKKRGGGGLGASWHRPDK | Transactivator of transcript-DV1-Bcl-2 TAT-DV1-BH5 | Apoptosis inducing | Cell viability assay, Transwell invasion assay | HEK-293 | Kidney cancer | Not specified |
| dbacp08271 | ZXR-2 | FKIGGFIKKLWRSLLA | Synthetic | Not Available | MTT assay | 293T | Kidney Cancer | IC50 = 6.3 ± 0.7 μM |