2 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp05093 | P6 | WYIRKIRRFFKWLKKKLKKK | Marine invertebrates | Inducing apoptosis | MTT assay | L02 | Colorectal cancer | Not found |
| dbacp05669 | Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) | MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV | Human | Cytotoxic effects | SDS-PAGE assay | L02 | Colorectal cancer | Not found |