7 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp04148 | LL 37 | [LL-37, 37 aa] | Also known human cathelicidin | Plasma membrane perturbations | MTT/MTS assay | MCF-7 | Breast cancer | LC50 : 21 at 100 µM |
| dbacp04149 | LL 37 | [LL-37, 37 aa] | Also known human cathelicidin | Plasma membrane perturbations | MTT/MTS assay | LNCaP | Prostate cancer | LC50 : 27 at 100 µM |
| dbacp04150 | LL 37 | [LL-37, 37 aa] | Also known human cathelicidin | Plasma membrane perturbations | MTT/MTS assay | OVRCAR-3 | Ovarian cancer | LC50 : 24 at 100 µM |
| dbacp04151 | LL-37 | [LL-37, 37 aa] | Human lysosomes of polymorphonuclear leukocytes | Not specified | Not specified | Not found | Not found | Not found |
| dbacp04152 | LL-37 | [LL-37, 37 aa] | Not found | Inducing apoptosis | Not specified | SAS-H1 | Not specified | Not found |
| dbacp04153 | LL-37 | [LL-37, 37 aa] | Not found | Inducing apoptosis | Not specified | HCT116 | Not specified | Not found |
| dbacp04154 | LL-37 parent | [LL-37, 37 aa] | Neutrophils, monocytes; mast cells; lymphocytes, Mesenchymal Stem Cells; islets; skin, sweat; airway surface liquid, saliva; colonic mucosa; bone marrow and testis, Human | Cytoplasmic membrane disintegration | Not specified | Not found | Not found | Not found |