dbACP: A Comprehensive Database of Anti-Cancer Peptides

7 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp04148 LL 37 [LL-37, 37 aa] Also known human cathelicidin Plasma membrane perturbations MTT/MTS assay MCF-7 Breast cancer LC50 : 21 at 100 µM
dbacp04149 LL 37 [LL-37, 37 aa] Also known human cathelicidin Plasma membrane perturbations MTT/MTS assay LNCaP Prostate cancer LC50 : 27 at 100 µM
dbacp04150 LL 37 [LL-37, 37 aa] Also known human cathelicidin Plasma membrane perturbations MTT/MTS assay OVRCAR-3 Ovarian cancer LC50 : 24 at 100 µM
dbacp04151 LL-37 [LL-37, 37 aa] Human lysosomes of polymorphonuclear leukocytes Not specified Not specified Not found Not found Not found
dbacp04152 LL-37 [LL-37, 37 aa] Not found Inducing apoptosis Not specified SAS-H1 Not specified Not found
dbacp04153 LL-37 [LL-37, 37 aa] Not found Inducing apoptosis Not specified HCT116 Not specified Not found
dbacp04154 LL-37 parent [LL-37, 37 aa] Neutrophils, monocytes; mast cells; lymphocytes, Mesenchymal Stem Cells; islets; skin, sweat; airway surface liquid, saliva; colonic mucosa; bone marrow and testis, Human Cytoplasmic membrane disintegration Not specified Not found Not found Not found