21 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp00739 | 9R | RRRRRNWMWC | Not found | Cell membrane disintegration; Apoptosis | MTT/MTS assay | LNCaP | Prostate cancer | IC50 : 44 µM |
| dbacp00740 | 9R | RRRRRNWMWC | Not found | Cell membrane disintegration; Apoptosis | MTT/MTS assay | LNCaP | Prostate cancer | IC50 : 23 µM |
| dbacp00741 | 9R | RRRRRNWMWC | Not found | Cell membrane disintegration; Apoptosis | MTT/MTS assay | LNCaP | Prostate cancer | IC50 : 28 µM |
| dbacp00752 | 9S1R | RRRRRWCMNW | Not found | Cell membrane disintegration; Apoptosis | MTT/MTS assay | LNCaP | Prostate cancer | IC50 : 26 µM |
| dbacp00753 | 9S1R | RRRRRWCMNW | Not found | Cell membrane disintegration; Apoptosis | MTT/MTS assay | LNCaP | Prostate cancer | IC50 : 9 µM |
| dbacp00754 | 9S1R | RRRRRWCMNW | Not found | Cell membrane disintegration; Apoptosis | MTT/MTS assay | LNCaP | Prostate cancer | IC50 : 8 µM |
| dbacp00980 | Adenoregulin | GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV | South American frog, Giant leaf frog | Cell membrane disintegration | LDH leakage assay | LNCaP | Prostate cancer | GI50 : 0.31 ± 0.15 µM |
| dbacp02632 | DC1 | GAFLKCGESCVYLPCLTTVVGCSCQNSVCYRD | Snake-needle grass | Apoptosis inducing | Colorimetric Cell viability assay,Migration assay ,Wound healing assay and Human prostate cancer xenograft assay | LNCap | Prostate cancer | Not found |
| dbacp02634 | DC2 | GAVPCGETCVYLPCITPDIGCSCQNKVCYRD | Snake-needle grass | Apoptosis inducing | Colorimetric Cell viability assay,Migration assay ,Wound healing assay and Human prostate cancer xenograft assay | LNCap | Prostate cancer | Not found |
| dbacp02636 | DC3 | GTSCGETCVLLPCLSSVLGCTCQNKRCYKD | Snake-needle grass | Apoptosis inducing | Colorimetric Cell viability assay,Migration assay ,Wound healing assay and Human prostate cancer xenograft assay | LNCap | Prostate cancer | Not found |
| dbacp03520 | Kassiniatuerin-3 | FIQHLIPLIPHAIQGIKDIF | Senegal running frog, Africa | Membranolytic mechanism | MTT assay | LNCaP | Non-small cell Lung cancer | IC50 : 3.79 µM |
| dbacp04149 | LL 37 | [LL-37, 37 aa] | Also known human cathelicidin | Plasma membrane perturbations | MTT/MTS assay | LNCaP | Prostate cancer | LC50 : 27 at 100 µM |
| dbacp04364 | Lytic | KLlLKlLkkLLKlLKKK | Transferrin receptor (TfR) | Disintegration of cell membrane | WST-1 assay | LNCaP | Prostate cancer | IC50 : 15.8 µM |
| dbacp04597 | Mauriporin (Non-disulfide-bridged peptide 2.8) (NDBP-2.8) | MNKKTLLVIFFITMLIVDEVNSFKIGGFIKKLWRSKLAKKLRAKGRELLKDYANRVINGGPEEEAAVPAERRR | Fat-tailed scorpion | Anti-proliferative action | Not specified | LnCAP | Prostate cancer | IC50 : 7.8 μM |
| dbacp05485 | Pexiganan | GIGKFLKKAKKFGKAFVKILKK | Analog of African clawed frog | Plasma membrane perturbations | MTT/MTS assay | LNCaP | Prostate cancer | LC50 : 6 at 100 µM |
| dbacp05527 | Phylloseptin-PBa1 | FLSLIPHIASGIASLVKNF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | LNCaP | Prostate cancer | IC50 : approx. 0.29 µM |
| dbacp05538 | Phylloseptin-PBa2 | FLSLLPHIASGIASLVSKF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | LNCaP | Prostate cancer | IC50 : approx. 0.50 µM |
| dbacp06060 | Sepia ink oligopeptide (SIO) | QPK | Not found | Inducing apoptosis | CCK-8 assay | LNCaP | Prostate cancer | IC50 : < 10 mg/mL |
| dbacp06339 | Transferrin receptor (TfR)-lytic hybrid peptide | THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK | Transferrin receptor (TfR) | Disintegration of cell membrane | WST-1 assay | LNCaP | Prostate cancer | IC50 : 6.2 µM |
| dbacp06865 | Pep-1-Phor21 | CGEMGWVRCKFAKFAKKFAKFAKKFAKFAK | Hybrid peptide PEP1 and Phor 21 | Not available | AlamarBlue assay | LNCaP | Liver Cancer | IC50 = 55.13 ± 13.56 µM |
| dbacp08079 | APETx4 | GTTCYCGKTIGIYWFGKYSCPTNRGYTGSCPYFLGICCYPVD | Anthopleura elegantissima | Not Available | CellTox Green Dye assay | LNCaP | Prostate Cancer | Green object count = 300 /mm2 at 20 μM |