dbACP: A Comprehensive Database of Anti-Cancer Peptides

21 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp00739 9R RRRRRNWMWC Not found Cell membrane disintegration; Apoptosis MTT/MTS assay LNCaP Prostate cancer IC50 : 44 µM
dbacp00740 9R RRRRRNWMWC Not found Cell membrane disintegration; Apoptosis MTT/MTS assay LNCaP Prostate cancer IC50 : 23 µM
dbacp00741 9R RRRRRNWMWC Not found Cell membrane disintegration; Apoptosis MTT/MTS assay LNCaP Prostate cancer IC50 : 28 µM
dbacp00752 9S1R RRRRRWCMNW Not found Cell membrane disintegration; Apoptosis MTT/MTS assay LNCaP Prostate cancer IC50 : 26 µM
dbacp00753 9S1R RRRRRWCMNW Not found Cell membrane disintegration; Apoptosis MTT/MTS assay LNCaP Prostate cancer IC50 : 9 µM
dbacp00754 9S1R RRRRRWCMNW Not found Cell membrane disintegration; Apoptosis MTT/MTS assay LNCaP Prostate cancer IC50 : 8 µM
dbacp00980 Adenoregulin GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV South American frog, Giant leaf frog Cell membrane disintegration LDH leakage assay LNCaP Prostate cancer GI50 : 0.31 ± 0.15 µM
dbacp02632 DC1 GAFLKCGESCVYLPCLTTVVGCSCQNSVCYRD Snake-needle grass Apoptosis inducing Colorimetric Cell viability assay,Migration assay ,Wound healing assay and Human prostate cancer xenograft assay LNCap Prostate cancer Not found
dbacp02634 DC2 GAVPCGETCVYLPCITPDIGCSCQNKVCYRD Snake-needle grass Apoptosis inducing Colorimetric Cell viability assay,Migration assay ,Wound healing assay and Human prostate cancer xenograft assay LNCap Prostate cancer Not found
dbacp02636 DC3 GTSCGETCVLLPCLSSVLGCTCQNKRCYKD Snake-needle grass Apoptosis inducing Colorimetric Cell viability assay,Migration assay ,Wound healing assay and Human prostate cancer xenograft assay LNCap Prostate cancer Not found
dbacp03520 Kassiniatuerin-3 FIQHLIPLIPHAIQGIKDIF Senegal running frog, Africa Membranolytic mechanism MTT assay LNCaP Non-small cell Lung cancer IC50 : 3.79 µM
dbacp04149 LL 37 [LL-37, 37 aa] Also known human cathelicidin Plasma membrane perturbations MTT/MTS assay LNCaP Prostate cancer LC50 : 27 at 100 µM
dbacp04364 Lytic KLlLKlLkkLLKlLKKK Transferrin receptor (TfR) Disintegration of cell membrane WST-1 assay LNCaP Prostate cancer IC50 : 15.8 µM
dbacp04597 Mauriporin (Non-disulfide-bridged peptide 2.8) (NDBP-2.8) MNKKTLLVIFFITMLIVDEVNSFKIGGFIKKLWRSKLAKKLRAKGRELLKDYANRVINGGPEEEAAVPAERRR Fat-tailed scorpion Anti-proliferative action Not specified LnCAP Prostate cancer IC50 : 7.8 μM
dbacp05485 Pexiganan GIGKFLKKAKKFGKAFVKILKK Analog of African clawed frog Plasma membrane perturbations MTT/MTS assay LNCaP Prostate cancer LC50 : 6 at 100 µM
dbacp05527 Phylloseptin-PBa1 FLSLIPHIASGIASLVKNF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay LNCaP Prostate cancer IC50 : approx. 0.29 µM
dbacp05538 Phylloseptin-PBa2 FLSLLPHIASGIASLVSKF Burmeister's leaf frog, Brazil, South America Disruption of cell membranes MTT cell viability assay LNCaP Prostate cancer IC50 : approx. 0.50 µM
dbacp06060 Sepia ink oligopeptide (SIO) QPK Not found Inducing apoptosis CCK-8 assay LNCaP Prostate cancer IC50 : < 10 mg/mL
dbacp06339 Transferrin receptor (TfR)-lytic hybrid peptide THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK Transferrin receptor (TfR) Disintegration of cell membrane WST-1 assay LNCaP Prostate cancer IC50 : 6.2 µM
dbacp06865 Pep-1-Phor21 CGEMGWVRCKFAKFAKKFAKFAKKFAKFAK Hybrid peptide PEP1 and Phor 21 Not available AlamarBlue assay LNCaP Liver Cancer IC50 = 55.13 ± 13.56 µM
dbacp08079 APETx4 GTTCYCGKTIGIYWFGKYSCPTNRGYTGSCPYFLGICCYPVD Anthopleura elegantissima Not Available CellTox Green Dye assay LNCaP Prostate Cancer Green object count = 300 /mm2 at 20 μM