dbACP: A Comprehensive Database of Anti-Cancer Peptides

8 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02651 Dermaseptin PS4 MDILKKSIFLVLFLGLVSLSICEEEKRENEDEEKQEDDEQSEEKRALWKTLLKHVGKAAGKAALNAVTDMVNQGEQ Sauvage's leaf frog Membrane disruption Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay MDA-MB-435S Lung cancer MIC : 10−9 to 10−4 M
dbacp02652 Dermaseptin PS4 MDILKKSIFLVLFLGLVSLSICEEEKRENEDEEKQEDDEQSEEKRALWKTLLKHVGKAAGKAALNAVTDMVNQGEQ Sauvage's leaf frog Membrane disruption Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay H157 Glioma MIC : 10−9 to 10−4 M
dbacp02653 Dermaseptin PS4 MDILKKSIFLVLFLGLVSLSICEEEKRENEDEEKQEDDEQSEEKRALWKTLLKHVGKAAGKAALNAVTDMVNQGEQ Sauvage's leaf frog Membrane disruption Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay PC-3 Prostate cancer MIC : 10−9 to 10−4 M
dbacp02654 Dermaseptin PS4 MDILKKSIFLVLFLGLVSLSICEEEKRENEDEEKQEDDEQSEEKRALWKTLLKHVGKAAGKAALNAVTDMVNQGEQ Sauvage's leaf frog Membrane disruption Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay MCF-7 Breast cancer MIC : 10−9 to 10−4 M
dbacp02727 Dermaseptin-PS4 ALWKTLLKHVGKAAGKAALNAVTDMVNQ Waxy monkey tree frog Membrane disruption Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay MDA-MB-435S Lung cancer MIC : 10−9 to 10−4 M
dbacp02728 Dermaseptin-PS4 ALWKTLLKHVGKAAGKAALNAVTDMVNQ Waxy monkey tree frog Membrane disruption Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay H157 Glioma MIC : 10−9 to 10−4 M
dbacp02729 Dermaseptin-PS4 ALWKTLLKHVGKAAGKAALNAVTDMVNQ Waxy monkey tree frog Membrane disruption Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay PC-3 Prostate cancer MIC : 10−9 to 10−4 M
dbacp02730 Dermaseptin-PS4 ALWKTLLKHVGKAAGKAALNAVTDMVNQ Waxy monkey tree frog Membrane disruption Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay MCF-7 Breast cancer MIC : 10−9 to 10−4 M