dbACP: A Comprehensive Database of Anti-Cancer Peptides

3 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp05221 Pediocin PA-1/ AcH KYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATGGHQGNHKC Lactic acid bacteria Cytoplasmic membrane disruption Not specified Not found Human colorectal cancer Not found
dbacp05573 Plantaricin A KSSAYSLQMGATAIKQVKKLFKKWGW Lactic acid bacteria Cell membrane disintegration Not specified Not found Colorectal cancer Not found
dbacp05574 Plantaricin A KSSAYSLQMGATAIKQVKKLFKKWGW Lactic acid bacteria Pore-formation Not specified Not found Not found Not found