dbACP: A Comprehensive Database of Anti-Cancer Peptides

8 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02662 Dermaseptin-L1 GLWSKIKEAAKAAGKAALNAVTGLVNQGDQPS Lemur leaf frog, South America Cell membrane disintegration Not specified Not found Colorectal cancer Not found
dbacp02663 Dermaseptin-L1 GLWSKIKEAAKAAGKAALNAVTGLVNQGDQPS Lemur leaf frog, South America Cell membrane disintegration Not specified Not found Colorectal cancer Not found
dbacp02664 Dermaseptin-L1 (DRS-L1) GLWSKIKEAAKAAGKAALNAVTGLVNQGDQPS Lemur leaf frog Cell membrane disintegration Not specified Not found Colorectal cancer Not found
dbacp02665 Dermaseptin-L1 (DRS-L1) GLWSKIKEAAKAAGKAALNAVTGLVNQGDQPS Lemur leaf frog Cell membrane disintegration Not specified Not found Colorectal cancer Not found
dbacp04638 Medusin-L1 LLGMIPLAISAISALSKL Lemur leaf frog Cell membrane disintegration Not specified Not found Colorectal cancer Not found
dbacp04639 Medusin-L1 (MDS-L1) (Phylloseptin-L1) (PLS-L1) LLGMIPLAISAISALSKL Lemur leaf frog Cell membrane disintegration Not specified Not found Colorectal cancer Not found
dbacp05507 Phylloseptin GLWSKIKEAAKAAGKAALNAVTGLVNQGDQPS Lemur leaf frog Cell membrane disintegration Not specified Not found Colorectal cancer Not found
dbacp05523 Phylloseptin-L1 LLGMIPLAISAISALSKL Lemur leaf frog Cell membrane disintegration Not specified Not found Colorectal cancer Not found