dbACP: A Comprehensive Database of Anti-Cancer Peptides

19 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp00319 [A18K]OCN-3N GIFDVLKNLAKGVITSLKS Derivatives of ocellatin-3N Membranolytic mechanism Not specified A549 Lung adenocarcinoma LC50 : 12-20 μM
dbacp00433 [D4K,A18K]OCN-3N GIFKVLKNLAKGVITSLKS Derivatives of ocellatin-3N Membranolytic mechanism Not specified A549 Lung adenocarcinoma LC50 : 12-20 μM
dbacp00436 [D4K]OCN-3N GIFKVLKNLAKGVITSLAS Derivatives of ocellatin-3N Not specified Lactate dehydrogenase (LDH) assay A549 Lung adenocarcinoma LC50 : 12-20 μM
dbacp00439 [G11k, N15K] alyteserin-2a ILGKLLSTAAGLLSNL Common midwife toad Cell-penetrating mechanism Cytotoxicity assay A549 Lung adenocarcinoma LC50 : 13 µM
dbacp00821 AaeAP1 FLFSLIPSVIAGLVSAIRN Venom, Aeneas fattailed scorpion, Africa Membrane lysis MTT assay NCI-H460 Human lung adenocarcinoma MIC : 10−4 to 10−9 M
dbacp00829 AaeAP2 FLFSLIPSAIAGLVSAIRN Venom, Aeneas fattailed scorpion, Africa Membrane lysis MTT assay NCI-H460 Human lung adenocarcinoma MIC : 10−4 to 10−9 M
dbacp01161 Antimicrobial peptide TsAP-1 MQIKHLITLFFLVLIVADQCSAFLSLIPSLVGGSISAFKGRRKREISAQIEQYKDLQKREAELEELLDRLPMY Brazilian scorpion Membrane disruption MTT Cell viability assay NCIeH838 Human Lung adenocarcinoma IC50 : 0.83 - 2.0 μM
dbacp02655 Dermaseptin-B2 GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV Giant leaf frog Immunomodulatory properties Cytotoxicity assays, Cell Titer-Glo Luminescent Cell viability assay A549 Lung adenocarcinoma LC50 : < 12 μM
dbacp02814 Drosophila Antennapedia homodomain PFV CALNNPFVYLI Fruit fly homodomain PFV Cell membrane disintegration SPR assay A549 Human lung adenocarcinoma Not found
dbacp02919 Esculentin-2CHa GFSSIFRGVAKFASKGLGKDLAKLGVDLVACKISKQC Chiricahua leopard frog Membrane disruption and cell lysis Cytotoxicity assay, Cell TiterGlo Luminescent cell viability assay A549 cells Lung adenocarcinoma LC50 : 10μM
dbacp02969 Frenatin 2.1S GLVGTLLGHIGKAILG Skin secretions, the Orinoco lime frog, north central Guyana, South America Immunomodulatory activity Cytotoxicity assay, Cell Titer-Glo Luminescent Cell Viability assay A549 Lung adenocarcinoma LC50 : 80 ± 6 μM
dbacp02970 Frenatin 2.1S (F2.3S) MAFLKKSLFLVLFLGLVSLSMGEREKREEEEEEEEENKEEEANEEGKGESEEKRGLVGTLLGHIGKAILGG Orinoco lime treefrog Not specified Cytotoxicity assay, Cell Titer-Glo Luminescent Cell Viability assay A549 Lung adenocarcinoma LC50 : 80 ± 6 µM
dbacp02971 Frenatin 2.2S GLVGTLLGHIGKAILS Skin secretions, the Orinoco lime frog, north central Guyana, South America Immunomodulatory activity Cytotoxicity assay, Cell Titer-Glo Luminescent Cell Viability assay A549 Lung adenocarcinoma LC50 : 75 ± 5 μM
dbacp05578 Pleurocidin GWGSFFKKAAHVGKHVGKAALTHYL Winter flounder Apoptosis inducing; Anti-proliferative activity MTT assay A549 Non-small cell lung adenocarcinoma IC50 : 300.8 µM
dbacp05583 Pleurocidin-a GWGSFFKKAAHVGKHVGKAALTHYL-NH5 Winter flounder Apoptosis inducing; Anti-proliferative activity MTT assay A549 Non-small cell lung adenocarcinoma IC50 : 42.1 µM
dbacp05676 Ps-1Pb IKIPSFFRNILKKVGKEAVSLIAGALKQS Merlin's dwarf gray frog Immunomodulatory properties Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay A549 Lung adenocarcinoma LC50 : < 12 μM
dbacp05679 Ps-2Pa GIFPIFAKLLGKVIKVASSLISKGRTE Merlin's dwarf gray frog Immunomodulatory properties Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay A549 Lung adenocarcinoma LC50 : < 12 μM
dbacp05821 R8 CALRRRRRRRR Not found Cell membrane disintegration SPR assay A549 Human lung adenocarcinoma Not found
dbacp07020 D-LAK-120-A kklalalakkwlalakklalalakk Synthetic ROS induction, mitochondria-mediated apoptosis. MTT assay HCC-827 Lung Adenocarcinoma IC50 between 4.0 and 5.5 μM