19 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp00319 | [A18K]OCN-3N | GIFDVLKNLAKGVITSLKS | Derivatives of ocellatin-3N | Membranolytic mechanism | Not specified | A549 | Lung adenocarcinoma | LC50 : 12-20 μM |
| dbacp00433 | [D4K,A18K]OCN-3N | GIFKVLKNLAKGVITSLKS | Derivatives of ocellatin-3N | Membranolytic mechanism | Not specified | A549 | Lung adenocarcinoma | LC50 : 12-20 μM |
| dbacp00436 | [D4K]OCN-3N | GIFKVLKNLAKGVITSLAS | Derivatives of ocellatin-3N | Not specified | Lactate dehydrogenase (LDH) assay | A549 | Lung adenocarcinoma | LC50 : 12-20 μM |
| dbacp00439 | [G11k, N15K] alyteserin-2a | ILGKLLSTAAGLLSNL | Common midwife toad | Cell-penetrating mechanism | Cytotoxicity assay | A549 | Lung adenocarcinoma | LC50 : 13 µM |
| dbacp00821 | AaeAP1 | FLFSLIPSVIAGLVSAIRN | Venom, Aeneas fattailed scorpion, Africa | Membrane lysis | MTT assay | NCI-H460 | Human lung adenocarcinoma | MIC : 10−4 to 10−9 M |
| dbacp00829 | AaeAP2 | FLFSLIPSAIAGLVSAIRN | Venom, Aeneas fattailed scorpion, Africa | Membrane lysis | MTT assay | NCI-H460 | Human lung adenocarcinoma | MIC : 10−4 to 10−9 M |
| dbacp01161 | Antimicrobial peptide TsAP-1 | MQIKHLITLFFLVLIVADQCSAFLSLIPSLVGGSISAFKGRRKREISAQIEQYKDLQKREAELEELLDRLPMY | Brazilian scorpion | Membrane disruption | MTT Cell viability assay | NCIeH838 | Human Lung adenocarcinoma | IC50 : 0.83 - 2.0 μM |
| dbacp02655 | Dermaseptin-B2 | GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV | Giant leaf frog | Immunomodulatory properties | Cytotoxicity assays, Cell Titer-Glo Luminescent Cell viability assay | A549 | Lung adenocarcinoma | LC50 : < 12 μM |
| dbacp02814 | Drosophila Antennapedia homodomain PFV | CALNNPFVYLI | Fruit fly homodomain PFV | Cell membrane disintegration | SPR assay | A549 | Human lung adenocarcinoma | Not found |
| dbacp02919 | Esculentin-2CHa | GFSSIFRGVAKFASKGLGKDLAKLGVDLVACKISKQC | Chiricahua leopard frog | Membrane disruption and cell lysis | Cytotoxicity assay, Cell TiterGlo Luminescent cell viability assay | A549 cells | Lung adenocarcinoma | LC50 : 10μM |
| dbacp02969 | Frenatin 2.1S | GLVGTLLGHIGKAILG | Skin secretions, the Orinoco lime frog, north central Guyana, South America | Immunomodulatory activity | Cytotoxicity assay, Cell Titer-Glo Luminescent Cell Viability assay | A549 | Lung adenocarcinoma | LC50 : 80 ± 6 μM |
| dbacp02970 | Frenatin 2.1S (F2.3S) | MAFLKKSLFLVLFLGLVSLSMGEREKREEEEEEEEENKEEEANEEGKGESEEKRGLVGTLLGHIGKAILGG | Orinoco lime treefrog | Not specified | Cytotoxicity assay, Cell Titer-Glo Luminescent Cell Viability assay | A549 | Lung adenocarcinoma | LC50 : 80 ± 6 µM |
| dbacp02971 | Frenatin 2.2S | GLVGTLLGHIGKAILS | Skin secretions, the Orinoco lime frog, north central Guyana, South America | Immunomodulatory activity | Cytotoxicity assay, Cell Titer-Glo Luminescent Cell Viability assay | A549 | Lung adenocarcinoma | LC50 : 75 ± 5 μM |
| dbacp05578 | Pleurocidin | GWGSFFKKAAHVGKHVGKAALTHYL | Winter flounder | Apoptosis inducing; Anti-proliferative activity | MTT assay | A549 | Non-small cell lung adenocarcinoma | IC50 : 300.8 µM |
| dbacp05583 | Pleurocidin-a | GWGSFFKKAAHVGKHVGKAALTHYL-NH5 | Winter flounder | Apoptosis inducing; Anti-proliferative activity | MTT assay | A549 | Non-small cell lung adenocarcinoma | IC50 : 42.1 µM |
| dbacp05676 | Ps-1Pb | IKIPSFFRNILKKVGKEAVSLIAGALKQS | Merlin's dwarf gray frog | Immunomodulatory properties | Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay | A549 | Lung adenocarcinoma | LC50 : < 12 μM |
| dbacp05679 | Ps-2Pa | GIFPIFAKLLGKVIKVASSLISKGRTE | Merlin's dwarf gray frog | Immunomodulatory properties | Cytotoxicity assays, CellTiter-Glo Luminescent cell viability assay | A549 | Lung adenocarcinoma | LC50 : < 12 μM |
| dbacp05821 | R8 | CALRRRRRRRR | Not found | Cell membrane disintegration | SPR assay | A549 | Human lung adenocarcinoma | Not found |
| dbacp07020 | D-LAK-120-A | kklalalakkwlalakklalalakk | Synthetic | ROS induction, mitochondria-mediated apoptosis. | MTT assay | HCC-827 | Lung Adenocarcinoma | IC50 between 4.0 and 5.5 μM |